🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TRUB2

DescriptionMitochondrial mRNA pseudouridine synthase TRUB2

Gene and Protein Information

Gene ID26995
Uniprot Accession IDs O95900 B7Z7G5
Ensembl ID ENSP00000361982
Symbol CLONE24922
FamilyBelongs to the pseudouridine synthase TruB family.
Sequence
MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRVRFLLGPMEGSEEKELTLTATSVPSFINHPLVCGPAFAHLKVGVGHRLDAQASGVLVLGVGHGCRLLTDMYNAHLTKDYTVRGLLGKATDDFREDGRLVEKTTYDHVTREKLDRILAVIQGSHQKALVMYSNLDLKTQEAYEMAVRGLIRPMNKSPMLITGIRCLYFAPPEFLLEVQCMHETQKELRKLVHEIGLELKTTAVCTQVRRTRDGFFTLDSALLRTQWDLTNIQDAIRAATPQVAAELEKSLSPGLDTKQLPSPGWSWDSQGPSSTLGLERGAGQ
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp464767TRUB2TruB pseudouridine synthase family member 29598VGNC:10115OMA, EggNOG
Macaque717619TRUB2TruB pseudouridine synthase family member 29544Inparanoid, OMA, EggNOG
Mouse227682Trub2TruB pseudouridine (psi) synthase family member 210090MGI:2442186Inparanoid, OMA, EggNOG
Rat366012Trub2TruB pseudouridine synthase family member 210116RGD:1359394Inparanoid, OMA, EggNOG
Dog608574TRUB2TruB pseudouridine synthase family member 29615VGNC:47889Inparanoid, OMA, EggNOG
Horse100070261TRUB2TruB pseudouridine synthase family member 29796VGNC:24570Inparanoid, OMA, EggNOG
Cow511988TRUB2TruB pseudouridine synthase family member 29913VGNC:36405Inparanoid, OMA, EggNOG
Pig100157964TRUB2TruB pseudouridine synthase family member 29823Inparanoid, OMA, EggNOG
Opossum100012751TRUB2TruB pseudouridine synthase family member 213616Inparanoid, EggNOG
Chicken417218TRUB2TruB pseudouridine synthase family member 29031CGNC:3653Inparanoid, OMA, EggNOG
Anole lizard100556023trub2TruB pseudouridine synthase family member 228377Inparanoid, OMA, EggNOG
Xenopus496499trub2TruB pseudouridine (psi) synthase family member 28364XB-GENE-996199Inparanoid, OMA, EggNOG
Zebrafish431747trub2TruB pseudouridine (psi) synthase family member 27955ZDB-GENE-040704-41Inparanoid, OMA, EggNOG
C. elegans177480Y43B11AR.3Uncharacterized protein6239OMA, EggNOG
Fruitfly35537CG7849CG7849 gene product from transcript CG7849-RB7227FBgn0033060Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.