224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Trypsin-3 |
|---|
Gene and Protein Information
| Gene ID | 5646 |
|---|---|
| Uniprot Accession IDs | P35030 A8CED1 A8CED3 A9Z1Y4 E7ES07 F8W7P3 P15951 Q15665 Q5VXV0 Q6ISJ4 Q9UQV3 |
| Ensembl ID | ENSP00000354280 |
| Symbol | PRSS4 TRY3 TRY4 T9 MTG TRY3 TRY4 PRSS4 |
| Family | Belongs to the peptidase S1 family. |
| Sequence | MCGPDDRCPARWPGPGRAVKCGKGLAAARPGRVERGGAQRGGAGLELHPLLGGRTWRAARDADGCEALGTVAVPFDDDDKIVGGYTCEENSLPYQVSLNSGSHFCGGSLISEQWVVSAAHCYKTRIQVRLGEHNIKVLEGNEQFINAAKIIRHPKYNRDTLDNDIMLIKLSSPAVINARVSTISLPTTPPAAGTECLISGWGNTLSFGADYPDELKCLDAPVLTQAECKASYPGKITNSMFCVGFLEGGKDSCQRDSGGPVVCNGQLQGVVSWGHGCAWKNRPGVYTKVYNYVDWIKDTIAANS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 22072 | Prss2 | protease, serine 2 | 10090 | MGI:102759 | Inparanoid, OMA |
| Dog | 100686744 | PRSS2 | protease, serine 2 | 9615 | Inparanoid, OMA | |
| Horse | 100055297 | LOC100055297 | anionic trypsin | 9796 | Inparanoid, OMA | |
| Opossum | 100010951 | LOC100010951 | anionic trypsin-like | 13616 | Inparanoid, OMA | |
| Platypus | 100086459 | LOC100086459 | cationic trypsin-3-like | 9258 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.