🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TNFRSF12A

DescriptionTumor necrosis factor receptor superfamily member 12A

Gene and Protein Information

Gene ID51330
Uniprot Accession IDs Q9NP84 D3DUA6 Q9HCS0
Ensembl ID ENSP00000326737
Symbol FN14 FN14 CD266 TWEAKR
Sequence
MARGSLRRLLRLLVLGLWLALLRSVAGEQAPGTAPCSRGSSWSADLDKCMDCASCRARPHSDFCLGCAAAPPAPFRLLWPILGGALSLTFVLGLLSGFLVWRRCRRREKFTTPIEETGGEGCPAVALIQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp107968771TNFRSF12ATNF receptor superfamily member 12A9598VGNC:5943OMA, EggNOG
Mouse27279Tnfrsf12atumor necrosis factor receptor superfamily, member 12a10090MGI:1351484Inparanoid, OMA, EggNOG
Rat302965Tnfrsf12aTNF receptor superfamily member 12A10116RGD:631329Inparanoid, OMA, EggNOG
Dog610734TNFRSF12ATNF receptor superfamily member 12A9615VGNC:47656Inparanoid, OMA, EggNOG
Horse100146755TNFRSF12ATNF receptor superfamily member 12A9796VGNC:24365Inparanoid, OMA, EggNOG
Cow617439TNFRSF12ATNF receptor superfamily member 12A9913VGNC:36162Inparanoid, OMA, EggNOG
Pig100217390TNFRSF12ATNF receptor superfamily member 12A9823Inparanoid, OMA, EggNOG
Opossum100017750TNFRSF12ATNF receptor superfamily member 12A13616Inparanoid, OMA, EggNOG
PlatypusTNFRSF12ATNF receptor superfamily member 12A [Source:HGNC Symbol;Acc:HGNC:18152]9258OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.