🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TNFSF9

DescriptionTumor necrosis factor ligand superfamily member 9

Gene and Protein Information

Gene ID8744
Uniprot Accession IDs P41273 Q2M3S2
Ensembl ID ENSP00000245817
Symbol CD137L TNLG5A 4-1BB-L
FamilyBelongs to the tumor necrosis factor family.
Sequence
MEYASDASLDPEAPWPPAPRARACRVLPWALVAGLLLLLLLAAACAVFLACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque700588TNFSF9TNF superfamily member 99544Inparanoid, OMA, EggNOG
Mouse21950Tnfsf9tumor necrosis factor (ligand) superfamily, member 910090MGI:1101058Inparanoid, OMA, EggNOG
Rat353218Tnfsf9TNF superfamily member 910116RGD:727974Inparanoid, OMA, EggNOG
Dog476729TNFSF9TNF superfamily member 99615VGNC:47674Inparanoid, OMA, EggNOG
Horse102150292TNFSF9TNF superfamily member 99796VGNC:52031Inparanoid, OMA, EggNOG
Cow521748TNFSF9TNF superfamily member 99913VGNC:36178Inparanoid, OMA, EggNOG
Pig100736831TNFSF9TNF superfamily member 99823OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.