224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Lymphokine-activated killer T-cell-originated protein kinase |
|---|
Gene and Protein Information
| Gene ID | 55872 |
|---|---|
| Uniprot Accession IDs | Q96KB5 B4DX68 D3DST2 Q9NPD9 Q9NYL7 Q9NZK6 |
| Ensembl ID | ENSP00000428489 |
| Symbol | TOPK SPK CT84 TOPK HEL164 Nori-3 |
| Family | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily. |
| Sequence | MEGISNFKTPSKLSEKKKSVLCSTPTINIPASPFMQKLGFGTGVNVYLMKRSPRGLSHSPWAVKKINPICNDHYRSVYQKRLMDEAKILKSLHHPNIVGYRAFTEANDGSLCLAMEYGGEKSLNDLIEERYKASQDPFPAAIILKVALNMARGLKYLHQEKKLLHGDIKSSNVVIKGDFETIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEAVEENGVITDKADIFAFGLTLWEMMTLSIPHINLSNDDDDEDKTFDESDFDDEAYYAALGTRPPINMEELDESYQKVIELFSVCTNEDPKDRPSAAHIVEALETDV Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464496 | PBK | PDZ binding kinase | 9598 | VGNC:825 | OMA, EggNOG |
| Macaque | 713242 | PBK | PDZ binding kinase | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 52033 | Pbk | PDZ binding kinase | 10090 | MGI:1289156 | Inparanoid, OMA, EggNOG |
| Rat | 290326 | Pbk | PDZ binding kinase | 10116 | RGD:1309565 | Inparanoid, OMA, EggNOG |
| Dog | 477371 | PBK | PDZ binding kinase | 9615 | Inparanoid, OMA, EggNOG | |
| Horse | 100060789 | PBK | PDZ binding kinase | 9796 | VGNC:21182 | Inparanoid, OMA, EggNOG |
| Cow | 534781 | PBK | PDZ binding kinase | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100141310 | PBK | PDZ binding kinase | 9823 | Inparanoid, OMA, EggNOG | |
| Platypus | 100077802 | PBK | PDZ binding kinase | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 422003 | PBK | PDZ binding kinase | 9031 | CGNC:12423 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100565867 | pbk | PDZ binding kinase | 28377 | OMA, EggNOG | |
| Xenopus | 496810 | pbk | PDZ binding kinase | 8364 | XB-GENE-1017083 | Inparanoid, OMA, EggNOG |
| Zebrafish | 360218 | pbk | PDZ binding kinase | 7955 | ZDB-GENE-030523-2 | Inparanoid, OMA, EggNOG |
| Fruitfly | 32753 | CG8173 | CG8173 gene product from transcript CG8173-RA | 7227 | FBgn0030864 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.