🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ENTPD2

DescriptionEctonucleoside triphosphate diphosphohydrolase 2

Gene and Protein Information

Gene ID954
Uniprot Accession IDs Q9Y5L3 O15464 Q5SPY6 Q5SPY7 NTPDase 2
Ensembl ID ENSP00000347213
Symbol CD39L1 CD39L1 NTPDase-2
FamilyBelongs to the GDA1/CD39 NTPase family.
Sequence
MAGKVRSLLPPLLLAAAGLAGLLLLCVPTRDVREPPALKYGIVLDAGSSHTSMFIYKWPADKENDTGIVGQHSSCDVPGGGISSYADNPSGASQSLVGCLEQALQDVPKERHAGTPLYLGATAGMRLLNLTNPEASTSVLMAVTHTLTQYPFDFRGARILSGQEEGVFGWVTANYLLENFIKYGWVGRWFRPRKGTLGAMDLGGASTQITFETTSPAEDRASEVQLHLYGQHYRVYTHSFLCYGRDQVLQRLLASALQTHGFHPCWPRGFSTQVLLGDVYQSPCTMAQRPQNFNSSARVSLSGSSDPHLCRDLVSGLFSFSSCPFSRCSFNGVFQPPVAGNFVAFSAFFYTVDFLRTSMGLPVATLQQLEAAAVNVCNQTWAQLQARVPGQRARLADYCAGAMFVQQLLSRGYGFDERAFGGVIFQKKAADTAVGWALGYMLNLTNLIPADPPGLRKGTDFSSWVVLLLLFASALLAALVLLLRQVHSAKLPSTI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp464883ENTPD2ectonucleoside triphosphate diphosphohydrolase 29598VGNC:13876OMA, EggNOG
Macaque721617ENTPD2ectonucleoside triphosphate diphosphohydrolase 29544Inparanoid, OMA, EggNOG
Mouse12496Entpd2ectonucleoside triphosphate diphosphohydrolase 210090MGI:1096863Inparanoid, OMA, EggNOG
Rat64467Entpd2ectonucleoside triphosphate diphosphohydrolase 210116RGD:69266Inparanoid, OMA, EggNOG
Dog491241ENTPD2ectonucleoside triphosphate diphosphohydrolase 29615VGNC:40381Inparanoid, OMA, EggNOG
Horse100066152ENTPD2ectonucleoside triphosphate diphosphohydrolase 29796VGNC:17596Inparanoid, OMA, EggNOG
Cow100126045ENTPD2ectonucleoside triphosphate diphosphohydrolase 29913VGNC:28509Inparanoid, OMA, EggNOG
Opossum100022598ENTPD2ectonucleoside triphosphate diphosphohydrolase 213616Inparanoid, EggNOG
Anole lizard100561926LOC100561926ectonucleoside triphosphate diphosphohydrolase 228377OMA, EggNOG
Xenopus407961entpd2ectonucleoside triphosphate diphosphohydrolase 28364XB-GENE-5810181Inparanoid, OMA, EggNOG
Zebrafish447905entpd2a.1ectonucleoside triphosphate diphosphohydrolase 2a, tandem duplicate 17955ZDB-GENE-040724-187OMA, EggNOG
Zebrafish569142entpd2bectonucleoside triphosphate diphosphohydrolase 2b7955ZDB-GENE-061013-2Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.