224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Transcription factor SOX-11 |
|---|
Gene and Protein Information
| Gene ID | 6664 |
|---|---|
| Uniprot Accession IDs | P35716 Q4ZFV8 |
| Ensembl ID | ENSP00000322568 |
| Symbol | MRD27 |
| Sequence | MVQQAESLEAESNLPREALDTEEGEFMACSPVALDESDPDWCKTASGHIKRPMNAFMVWSKIERRKIMEQSPDMHNAEISKRLGKRWKMLKDSEKIPFIREAERLRLKHMADYPDYKYRPRKKPKMDPSAKPSASQSPEKSAAGGGGGSAGGGAGGAKTSKGSSKKCGKLKAPAAAGAKAGAGKAAQSGDYGGAGDDYVLGSLRVSGSGGGGAGKTVKCVFLDEDDDDDDDDDELQLQIKQEPDEEDEEPPHQQLLQPPGQQPSQLLRRYNVAKVPASPTLSSSAESPEGASLYDEVRAGATSGAGGGSRLYYSFKNITKQHPPPLAQPALSPASSRSVSTSSSSSSGSSSGSSGEDADDLMFDLSLNFSQSAHSASEQQLGGGAAAGNLSLSLVDKDLDSFSEGSLGSHFEFPDYCTPELSEMIAGDWLEANFSDLVFTY Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 20666 | Sox11 | SRY (sex determining region Y)-box 11 | 10090 | MGI:98359 | Inparanoid, OMA |
| Rat | 84046 | Sox11 | SRY box 11 | 10116 | RGD:69351 | Inparanoid, OMA |
| Horse | 100146709 | SOX11 | SRY-box 11 | 9796 | VGNC:51406 | Inparanoid, OMA |
| Chicken | 396104 | SOX11 | SRY-box 11 | 9031 | CGNC:12274 | Inparanoid, OMA |
| Anole lizard | 100560274 | sox11 | SRY-box 11 | 28377 | Inparanoid, OMA | |
| Zebrafish | 30603 | sox11b | SRY (sex determining region Y)-box 11b | 7955 | ZDB-GENE-980526-466 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.