🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

NAPG

DescriptionGamma-soluble NSF attachment protein

Gene and Protein Information

Gene ID8774
Uniprot Accession IDs Q99747 B4DFC9 Q9BUV1 SNAP-gamma
Ensembl ID ENSP00000324628
Symbol SNAPG GAMMASNAP
FamilyBelongs to the SNAP family.
Sequence
MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENEERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp468475NAPGNSF attachment protein gamma9598VGNC:7326OMA, EggNOG
Mouse108123NapgN-ethylmaleimide sensitive fusion protein attachment protein gamma10090MGI:104561Inparanoid, OMA, EggNOG
Rat307382NapgNSF attachment protein gamma10116RGD:1310109Inparanoid, OMA
Dog608647NAPGNSF attachment protein gamma9615VGNC:43622Inparanoid, OMA, EggNOG
Horse100050057NAPGNSF attachment protein gamma9796VGNC:20562Inparanoid, OMA, EggNOG
Cow509041NAPGNSF attachment protein gamma9913VGNC:31884Inparanoid, OMA, EggNOG
Opossum100013513NAPGNSF attachment protein gamma13616Inparanoid, OMA, EggNOG
Platypus100074713NAPGNSF attachment protein gamma9258Inparanoid, OMA, EggNOG
Chicken421051NAPGNSF attachment protein gamma9031CGNC:51393Inparanoid, OMA, EggNOG
Anole lizard100556211napgNSF attachment protein gamma28377Inparanoid, OMA, EggNOG
Xenopus100135361napgN-ethylmaleimide-sensitive factor attachment protein, gamma8364XB-GENE-967831Inparanoid, OMA, EggNOG
Zebrafish541353napgaN-ethylmaleimide-sensitive factor attachment protein, gamma a7955ZDB-GENE-050320-46OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.