224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Mothers against decapentaplegic homolog 5 |
|---|
Gene and Protein Information
| Gene ID | 4090 |
|---|---|
| Uniprot Accession IDs | Q99717 O14688 Q15798 Q9UQA1 MAD homolog 5 |
| Ensembl ID | ENSP00000441954 |
| Symbol | MADH5 DWFC JV5-1 MADH5 |
| Family | Belongs to the dwarfin/SMAD family. |
| Sequence | MTSMASLFSFTSPAVKRLLGWKQGDEEEKWAEKAVDALVKKLKKKKGAMEELEKALSSPGQPSKCVTIPRSLDGRLQVSHRKGLPHVIYCRVWRWPDLQSHHELKPLDICEFPFGSKQKEVCINPYHYKRVESPVLPPVLVPRHNEFNPQHSLLVQFRNLSHNEPHMPQNATFPDSFHQPNNTPFPLSPNSPYPPSPASSTYPNSPASSGPGSPFQLPADTPPPAYMPPDDQMGQDNSQPMDTSNNMIPQIMPSISSRDVQPVAYEEPKHWCSIVYYELNNRVGEAFHASSTSVLVDGFTDPSNNKSRFCLGLLSNVNRNSTIENTRRHIGKGVHLYYVGGEVYAECLSDSSIFVQSRNCNFHHGFHPTTVCKIPSSCSLKIFNNQEFAQLLAQSVNHGFEAVYELTKMCTIRMSFVKGWGAEYHRQDVTSTPCWIEIHLHGPLQWLDKVLTQMGSPLNPISSVS Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Macaque | 712645 | SMAD5 | SMAD family member 5 | 9544 | Inparanoid, OMA | |
| Mouse | 17129 | Smad5 | SMAD family member 5 | 10090 | MGI:1328787 | Inparanoid, OMA |
| Rat | 59328 | Smad5 | SMAD family member 5 | 10116 | RGD:620158 | Inparanoid, OMA |
| Dog | 481520 | SMAD5 | SMAD family member 5 | 9615 | VGNC:46522 | Inparanoid, OMA |
| Horse | 100033851 | SMAD5 | SMAD family member 5 | 9796 | VGNC:23314 | Inparanoid, OMA |
| Cow | 768050 | SMAD5 | SMAD family member 5 | 9913 | VGNC:34978 | Inparanoid, OMA |
| Chicken | 395679 | SMAD5 | SMAD family member 5 | 9031 | CGNC:4741 | Inparanoid, OMA |
| Anole lizard | 100564659 | smad5 | SMAD family member 5 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 30641 | smad5 | SMAD family member 5 | 7955 | ZDB-GENE-990603-9 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.