224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Tumor necrosis factor ligand superfamily member 12 |
|---|
Gene and Protein Information
| Gene ID | 407977 |
|---|---|
| Uniprot Accession IDs | O43508 Q8IZK7 Q8WUZ7 |
| Ensembl ID | ENSP00000293825 |
| Symbol | APO3L DR3LG TWE-PRIL |
| Family | Belongs to the tumor necrosis factor family. |
| Sequence | MAARRSQRRRGRRGEPGTALLVPLALGLGLALACLGLLLAVVSLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 100551503 | TNFSF12 | TNF superfamily member 12 | 9598 | VGNC:14220 | Inparanoid, OMA |
| Mouse | 21944 | Tnfsf12 | tumor necrosis factor (ligand) superfamily, member 12 | 10090 | MGI:1196259 | Inparanoid, OMA |
| Opossum | 100551511 | TNFSF12 | TNF superfamily member 12 | 13616 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.