224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Mothers against decapentaplegic homolog 7 |
|---|
Gene and Protein Information
| Gene ID | 4092 |
|---|---|
| Uniprot Accession IDs | O15105 B7Z773 K7EQ10 O14740 Q6DK23 MAD homolog 7 |
| Ensembl ID | ENSP00000262158 |
| Symbol | MADH7 MADH8 CRCS3 MADH7 MADH8 |
| Family | Belongs to the dwarfin/SMAD family. |
| Sequence | MFRTKRSALVRRLWRSRAPGGEDEEEGAGGGGGGGELRGEGATDSRAHGAGGGGPGRAGCCLGKAVRGAKGHHHPHPPAAGAGAAGGAEADLKALTHSVLKKLKERQLELLLQAVESRGGTRTACLLLPGRLDCRLGPGAPAGAQPAQPPSSYSLPLLLCKVFRWPDLRHSSEVKRLCCCESYGKINPELVCCNPHHLSRLCELESPPPPYSRYPMDFLKPTADCPDAVPSSAETGGTNYLAPGGLSDSQLLLEPGDRSHWCVVAYWEEKTRVGRLYCVQEPSLDIFYDLPQGNGFCLGQLNSDNKSQLVQKVRSKIGCGIQLTREVDGVWVYNRSSYPIFIKSATLDNPDSRTLLVHKVFPGFSIKAFDYEKAYSLQRPNDHEFMQQPWTGFTVQISFVKGWGQCYTRQFISSCPCWLEVIFNSR Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 455411 | SMAD7 | SMAD family member 7 | 9598 | VGNC:5207 | OMA, EggNOG |
| Mouse | 17131 | Smad7 | SMAD family member 7 | 10090 | MGI:1100518 | Inparanoid, OMA, EggNOG |
| Rat | 81516 | Smad7 | SMAD family member 7 | 10116 | RGD:69314 | Inparanoid, OMA, EggNOG |
| Dog | 490570 | SMAD7 | SMAD family member 7 | 9615 | VGNC:46524 | Inparanoid, OMA, EggNOG |
| Horse | 100033853 | SMAD7 | SMAD family member 7 | 9796 | VGNC:50974 | Inparanoid, OMA, EggNOG |
| Cow | 535916 | SMAD7 | SMAD family member 7 | 9913 | VGNC:34980 | Inparanoid, OMA, EggNOG |
| Pig | 100521305 | SMAD7 | SMAD family member 7 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100019714 | SMAD7 | SMAD family member 7 | 13616 | Inparanoid, OMA, EggNOG | |
| Xenopus | 100486892 | smad7 | SMAD family member 7 | 8364 | XB-GENE-486004 | Inparanoid, OMA |
| Zebrafish | 326282 | smad7 | SMAD family member 7 | 7955 | ZDB-GENE-030128-3 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.