🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

SNAP29

DescriptionSynaptosomal-associated protein 29

Gene and Protein Information

Gene ID9342
Uniprot Accession IDs O95721 SNAP-29
Ensembl ID ENSP00000215730
Symbol CEDNIK SNAP-29
FamilyBelongs to the SNAP-25 family.
Sequence
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp458669SNAP29synaptosome associated protein 299598VGNC:6006OMA, EggNOG
Macaque696708SNAP29synaptosome associated protein 299544Inparanoid, OMA, EggNOG
Mouse67474Snap29synaptosomal-associated protein 2910090MGI:1914724Inparanoid, OMA, EggNOG
Rat116500Snap29synaptosome associated protein 2910116RGD:620225Inparanoid, OMA, EggNOG
Dog486442SNAP29synaptosome associated protein 299615VGNC:46589Inparanoid, OMA, EggNOG
Horse100050930SNAP29synaptosome associated protein 299796VGNC:23375Inparanoid, OMA, EggNOG
Cow532261SNAP29synaptosome associated protein 299913VGNC:35052Inparanoid, OMA, EggNOG
Pig100154733SNAP29synaptosome associated protein 299823OMA, EggNOG
Opossum100015406SNAP29synaptosome associated protein 2913616Inparanoid, OMA, EggNOG
Anole lizard100554635snap29synaptosome associated protein 2928377Inparanoid, OMA, EggNOG
Xenopus394585snap29synaptosome associated protein 29kDa8364XB-GENE-941286Inparanoid, OMA, EggNOG
Zebrafish553460snap29synaptosomal-associated protein 297955ZDB-GENE-041111-226Inparanoid, OMA
C. elegans176233snap-29Soluble NSF attachment protein 296239Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    membrane traffic protein    /    SNARE protein    /    Synaptosomal-associated protein 29
DTO Classes
protein    /    Transporter    /    SNARE protein    /    Synaptosomal-associated protein 29

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.