🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ERP44

DescriptionEndoplasmic reticulum resident protein 44

Gene and Protein Information

Gene ID23071
Uniprot Accession IDs Q9BS26 O60319 Q4VXC1 Q5VWZ7 Q6UW14 Q8WX67 ER protein 44
Ensembl ID ENSP00000262455
Symbol KIAA0573 TXNDC4 PDIA10 TXNDC4
Sequence
MHPAVFLSLPDLRCSLLLLVTWVFTPVTTEITSLDTENIDEILNNADVALVNFYADWCRFSQMLHPIFEEASDVIKEEFPNENQVVFARVDCDQHSDIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVKALADYIRQQKSDPIQEIRDLAEITTLDRSKRNIIGYFEQKDSDNYRVFERVANILHDDCAFLSAFGDVSKPERYSGDNIIYKPPGHSAPDMVYLGAMTNFDVTYNWIQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTESLEIFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFGDFKDVLIPGKLKQFVFDLHSGKLHREFHHGPDPTDTAPGEQAQDVASSPPESSFQKLAPSEYRYTLLRDRDEL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp464616ERP44endoplasmic reticulum protein 449598VGNC:13877OMA, EggNOG
Macaque100423317ERP44endoplasmic reticulum protein 449544Inparanoid, OMA, EggNOG
Mouse76299Erp44endoplasmic reticulum protein 4410090MGI:1923549Inparanoid, OMA, EggNOG
Rat298066Erp44endoplasmic reticulum protein 4410116RGD:1309176Inparanoid, OMA, EggNOG
Dog474781ERP44endoplasmic reticulum protein 449615VGNC:51716OMA, EggNOG
Horse100054749ERP44endoplasmic reticulum protein 449796VGNC:17676Inparanoid, OMA, EggNOG
Cow506157ERP44endoplasmic reticulum protein 449913VGNC:28597Inparanoid, OMA, EggNOG
Opossum100011005ERP44endoplasmic reticulum protein 4413616Inparanoid, OMA, EggNOG
PlatypusERP44endoplasmic reticulum protein 44 [Source:HGNC Symbol;Acc:HGNC:18311]9258OMA, EggNOG
Chicken420994ERP44endoplasmic reticulum protein 449031CGNC:10115Inparanoid, OMA, EggNOG
Anole lizardERP44endoplasmic reticulum protein 44 [Source:HGNC Symbol;Acc:HGNC:18311]28377Inparanoid, OMA, EggNOG
Xenopus496539erp44endoplasmic reticulum protein 448364XB-GENE-962188Inparanoid, OMA, EggNOG
Zebrafish393866erp44endoplasmic reticulum protein 447955ZDB-GENE-040426-1902Inparanoid, OMA, EggNOG
Fruitfly32588CG9911CG9911 gene product from transcript CG9911-RD7227FBgn0030734Inparanoid, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.