224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | G-protein coupled receptor 20 |
|---|
Gene and Protein Information
| Gene ID | 2843 |
|---|---|
| Uniprot Accession IDs | Q99678 Q17R96 |
| Ensembl ID | ENSP00000366970 |
| Family | Belongs to the G-protein coupled receptor 1 family. |
| Sequence | MPSVSPAGPSAGAVPNATAVTTVRTNASGLEVPLFHLFARLDEELHGTFPGLWLALMAVHGAIFLAGLVLNGLALYVFCCRTRAKTPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 737712 | GPR20 | G protein-coupled receptor 20 | 9598 | VGNC:50314 | OMA, EggNOG |
| Mouse | 239530 | Gpr20 | G protein-coupled receptor 20 | 10090 | MGI:2441803 | Inparanoid, OMA, EggNOG |
| Dog | 482061 | GPR20 | G protein-coupled receptor 20 | 9615 | VGNC:41425 | Inparanoid, OMA, EggNOG |
| Horse | 100069651 | GPR20 | G protein-coupled receptor 20 | 9796 | VGNC:18535 | Inparanoid, OMA, EggNOG |
| Cow | 515695 | GPR20 | G protein-coupled receptor 20 | 9913 | VGNC:29579 | Inparanoid, OMA, EggNOG |
| Pig | GPR20 | G protein-coupled receptor 20 [Source:HGNC Symbol;Acc:HGNC:4475] | 9823 | OMA, EggNOG | ||
| Opossum | 100032760 | GPR20 | G protein-coupled receptor 20 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | GPR20 | G protein-coupled receptor 20 [Source:HGNC Symbol;Acc:HGNC:4475] | 9258 | OMA, EggNOG | ||
| Anole lizard | 100556704 | gpr20 | G protein-coupled receptor 20 | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | gpr20 | G protein-coupled receptor 20 [Source:Xenbase;Acc:XB-GENE-6040269] | 8364 | OMA, EggNOG | ||
| Zebrafish | 794428 | gpr20 | G protein-coupled receptor 20 | 7955 | ZDB-GENE-140106-136 | OMA, EggNOG |
Protein Classes
DTO Classes
protein / G-protein coupled receptor / Class A rhodopsin like / Purinoceptor / G-protein coupled receptor 20
protein / G-protein coupled receptor / Class A rhodopsin like / Purinoceptor / G-protein coupled receptor 20
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.