224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | N-lysine methyltransferase SMYD2 |
|---|
Gene and Protein Information
| Gene ID | 56950 |
|---|---|
| Uniprot Accession IDs | Q9NRG4 B2R9P9 I6L9H7 Q4V765 Q5VSH9 Q96AI4 |
| Ensembl ID | ENSP00000355924 |
| Symbol | KMT3C KMT3C HSKM-B ZMYND14 |
| Family | Belongs to the class V-like SAM-binding methyltransferase superfamily. |
| Sequence | MRAEGLGGLERFCSPGKGRGLRALQPFQVGDLLFSCPAYAYVLTVNERGNHCEYCFTRKEGLSKCGRCKQAFYCNVECQKEDWPMHKLECSPMVVFGENWNPSETVRLTARILAKQKIHPERTPSEKLLAVKEFESHLDKLDNEKKDLIQSDIAALHHFYSKHLGFPDNDSLVVLFAQVNCNGFTIEDEELSHLGSAIFPDVALMNHSCCPNVIVTYKGTLAEVRAVQEIKPGEEVFTSYIDLLYPTEDRNDRLRDSYFFTCECQECTTKDKDKAKVEIRKLSDPPKAEAIRDMVRYARNVIEEFRRAKHYKSPSELLEICELSQEKMSSVFEDSNVYMLHMMYQAMGVCLYMQDWEGALQYGQKIIKPYSKHYPLYSLNVASMWLKLGRLYMGLEHKAAGEKALKKAIAIMEVAHGKDHPYISEIKQEIESH Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 457729 | SMYD2 | SET and MYND domain containing 2 | 9598 | VGNC:1558 | OMA, EggNOG |
| Macaque | 709375 | SMYD2 | SET and MYND domain containing 2 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 226830 | Smyd2 | SET and MYND domain containing 2 | 10090 | MGI:1915889 | Inparanoid, OMA, EggNOG |
| Rat | 289372 | Smyd2 | SET and MYND domain containing 2 | 10116 | RGD:727785 | Inparanoid, OMA, EggNOG |
| Dog | 480026 | SMYD2 | SET and MYND domain containing 2 | 9615 | VGNC:53836 | Inparanoid, OMA, EggNOG |
| Horse | 100052774 | SMYD2 | SET and MYND domain containing 2 | 9796 | VGNC:23367 | Inparanoid, OMA, EggNOG |
| Cow | 615229 | SMYD2 | SET and MYND domain containing 2 | 9913 | VGNC:35043 | Inparanoid, OMA, EggNOG |
| Pig | 100294706 | SMYD2 | SET and MYND domain containing 2 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | 100023305 | SMYD2 | SET and MYND domain containing 2 | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100079176 | SMYD2 | SET and MYND domain containing 2 | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 421361 | SMYD2 | SET and MYND domain containing 2 | 9031 | CGNC:7436 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100557667 | smyd2 | SET and MYND domain containing 2 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 541423 | smyd2a | SET and MYND domain containing 2a | 7955 | ZDB-GENE-050320-126 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / transcription factor / transcription cofactor / N-lysine methyltransferase SMYD2
protein / transcription factor / transcription cofactor / N-lysine methyltransferase SMYD2
DTO Classes
protein / Epigenetic regulator / Writer / Protein methyltransferase / SET domain / N-lysine methyltransferase SMYD2
protein / Epigenetic regulator / Writer / Protein methyltransferase / SET domain / N-lysine methyltransferase SMYD2
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.