🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

S100A10

DescriptionProtein S100-A10

Gene and Protein Information

Gene ID6281
Uniprot Accession IDs P60903 A8K4V8 P08206 Q5T1C5
Ensembl ID ENSP00000357801
Symbol ANX2LG CAL1L CLP11 42C P11 p10 GP11 ANX2L CAL1L CLP11 Ca[1] ANX2LG
FamilyBelongs to the S-100 family.
Sequence
MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLDQCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp457306S100A10S100 calcium binding protein A109598VGNC:1522OMA, EggNOG
Mouse20194S100a10S100 calcium binding protein A10 (calpactin)10090MGI:1339468Inparanoid, OMA, EggNOG
Rat81778S100a10S100 calcium binding protein A1010116RGD:628655Inparanoid, OMA
Dog475851S100A10S100 calcium binding protein A109615Inparanoid, OMA
Horse100034012S100A10S100 calcium binding protein A109796VGNC:22646Inparanoid, OMA, EggNOG
Cow282466S100A10S100 calcium binding protein A109913VGNC:34237Inparanoid, OMA, EggNOG
Pig100515138S100A10S100 calcium binding protein A109823OMA, EggNOG
Opossum100016292S100A10S100 calcium binding protein A1013616OMA, EggNOG
Anole lizard100564227s100a10S100 calcium binding protein A1028377Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    calcium-binding protein    /    calmodulin    /    Protein S100-A10
protein    /    calcium-binding protein    /    signaling molecule    /    Protein S100-A10
DTO Classes
protein    /    Calcium-binding protein    /    Intracellular calcium-sensing protein    /    Calmodulin    /    Protein S100-A10

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.