🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

SCNN1B

DescriptionAmiloride-sensitive sodium channel subunit beta

Gene and Protein Information

Gene ID6338
Uniprot Accession IDs P51168 C5HTZ2 O60891 Q96KG2 Q9UJ32 Q9UMU5
Ensembl ID ENSP00000345751
Symbol BESC1 ENaCb SCNEB LIDLS1 ENaCbeta
FamilyBelongs to the amiloride-sensitive sodium channel (TC 1.A.6) family. SCNN1B subfamily.
Sequence
MHVKKYLLKGLHRLQKGPGYTYKELLVWYCDNTNTHGPKRIICEGPKKKAMWFLLTLLFAALVCWQWGIFIRTYLSWEVSVSLSVGFKTMDFPAVTICNASPFKYSKIKHLLKDLDELMEAVLERILAPELSHANATRNLNFSIWNHTPLVLIDERNPHHPMVLDLFGDNHNGLTSSSASEKICNAHGCKMAMRLCSLNRTQCTFRNFTSATQALTEWYILQATNIFAQVPQQELVEMSYPGEQMILACLFGAEPCNYRNFTSIFYPHYGNCYIFNWGMTEKALPSANPGTEFGLKLILDIGQEDYVPFLASTAGVRLMLHEQRSYPFIRDEGIYAMSGTETSIGVLVDKLQRMGEPYSPCTVNGSEVPVQNFYSDYNTTYSIQACLRSCFQDHMIRNCNCGHYLYPLPRGEKYCNNRDFPDWAHCYSDLQMSVAQRETCIGMCKESCNDTQYKMTISMADWPSEASEDWIFHVLSQERDQSTNITLSRKGIVKLNIYFQEFNYRTIEESAANNIVWLLSNLGGQFGFWMGGSVLCLIEFGEIIIDFVWITIIKLVALAKSLRQRRAQASYAGPPPTVAELVEAHTNFGFQPDTAPRSPNTGPYPSEQALPIPGTPPPNYDSLRLQPLDVIESDSEGDAI
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp453984SCNN1Bsodium channel epithelial 1 beta subunit9598VGNC:9392Inparanoid, OMA, EggNOG
Macaque700093SCNN1Bsodium channel epithelial 1 beta subunit9544Inparanoid, OMA, EggNOG
Mouse20277Scnn1bsodium channel, nonvoltage-gated 1 beta10090MGI:104696Inparanoid, OMA, EggNOG
Rat24767Scnn1bsodium channel epithelial 1 beta subunit10116RGD:3640Inparanoid, OMA, EggNOG
Dog489972SCNN1Bsodium channel epithelial 1 beta subunit9615VGNC:45926OMA, EggNOG
Horse100069008SCNN1Bsodium channel epithelial 1 beta subunit9796VGNC:22745Inparanoid, OMA, EggNOG
Cow533355SCNN1Bsodium channel epithelial 1 beta subunit9913VGNC:34356Inparanoid, OMA, EggNOG
Pig100627971SCNN1Bsodium channel epithelial 1 beta subunit9823OMA, EggNOG
Opossum100027536SCNN1Bsodium channel epithelial 1 beta subunit13616Inparanoid, OMA, EggNOG
Platypus100079130SCNN1Bsodium channel epithelial 1 beta subunit9258Inparanoid, OMA, EggNOG
Chicken427673SCNN1Bsodium channel epithelial 1 beta subunit9031CGNC:4654Inparanoid, OMA, EggNOG
Anole lizard100567232scnn1bsodium channel epithelial 1 beta subunit28377Inparanoid, OMA, EggNOG
Xenopus779891scnn1bsodium channel, non voltage gated 1 beta subunit8364XB-GENE-949109Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    transporter    /    ion channel    /    Amiloride-sensitive sodium channel subunit beta
DTO Classes
protein    /    Ion channel    /    Amiloride-sensitive sodium channel family    /    SCNN1B subfamily    /    Amiloride-sensitive sodium channel subunit beta

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.