224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Gamma-sarcoglycan |
|---|
Gene and Protein Information
| Gene ID | 6445 |
|---|---|
| Uniprot Accession IDs | Q13326 Q32M32 Q5T9J6 Gamma-SG |
| Ensembl ID | ENSP00000218867 |
| Symbol | A4 MAM DMDA SCG3 35DAG DAGA4 DMDA1 LGMD2C LGMDR5 SCARMD2 gamma-SG |
| Family | Belongs to the sarcoglycan beta/delta/gamma/zeta family. |
| Sequence | MVREQYTTATEGICIERPENQYVYKIGIYGWRKRCLYLFVLLLLIILVVNLALTIWILKVMWFSPAGMGHLCVTKDGLRLEGESEFLFPLYAKEIHSRVDSSLLLQSTQNVTVNARNSEGEVTGRLKVGPKMVEVQNQQFQINSNDGKPLFTVDEKEVVVGTDKLRVTGPEGALFEHSVETPLVRADPFQDLRLESPTRSLSMDAPRGVHIQAHAGKIEALSQMDILFHSSDGMLVLDAETVCLPKLVQGTWGPSGSSQSLYEICVCPDGKLYLSVAGVSTTCQEHNHICL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 745014 | SGCG | sarcoglycan gamma | 9598 | VGNC:5107 | OMA, EggNOG |
| Macaque | 721411 | SGCG | sarcoglycan gamma | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 24053 | Sgcg | sarcoglycan, gamma (dystrophin-associated glycoprotein) | 10090 | MGI:1346524 | Inparanoid, OMA, EggNOG |
| Rat | 305941 | Sgcg | sarcoglycan, gamma | 10116 | RGD:1359577 | Inparanoid, OMA, EggNOG |
| Dog | 486043 | SGCG | sarcoglycan gamma | 9615 | VGNC:46095 | Inparanoid, OMA, EggNOG |
| Horse | 100050428 | SGCG | sarcoglycan gamma | 9796 | VGNC:22915 | Inparanoid, OMA, EggNOG |
| Cow | 506155 | SGCG | sarcoglycan gamma | 9913 | VGNC:34539 | Inparanoid, OMA, EggNOG |
| Pig | 100623668 | SGCG | sarcoglycan gamma | 9823 | OMA, EggNOG | |
| Opossum | 100024300 | SGCG | sarcoglycan gamma | 13616 | Inparanoid, OMA, EggNOG | |
| Platypus | 100089943 | SGCG | sarcoglycan gamma | 9258 | Inparanoid, OMA, EggNOG | |
| Chicken | 418945 | SGCG | sarcoglycan gamma | 9031 | CGNC:12861 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100561756 | sgcg | sarcoglycan gamma | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 780370 | sgcg | sarcoglycan gamma | 8364 | XB-GENE-956423 | Inparanoid, OMA, EggNOG |
| Zebrafish | 445292 | sgcg | sarcoglycan, gamma | 7955 | ZDB-GENE-030724-2 | Inparanoid, OMA |
| C. elegans | 184162 | sgn-1 | SarcoGlycaN | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 31129 | Scgdelta | Sarcoglycan delta | 7227 | FBgn0025391 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.