TAS2R10

DescriptionTaste receptor type 2 member 10

Gene and Protein Information

Gene ID50839
Uniprot Accession IDs Q9NYW0 Q3MIM9 Q6NTD9 T2R10
Ensembl ID ENSP00000240619
Symbol TRB2 T2R10
FamilyBelongs to the G-protein coupled receptor T2R family.
Sequence
MLRVVEGIFIFVVVSESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWIIITDGFIQIFSPNIYASGNLIEYISYFWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLWLKSRTNMVLPFMIVFLLISSLLNFAYIAKILNDYKTKNDTVWDLNMYKSEYFIKQILLNLGVIFFFTLSLITCIFLIISLWRHNRQMQSNVTGLRDSNTEAHVKAMKVLISFIILFILYFIGMAIEISCFTVRENKLLLMFGMTTTAIYPWGHSFILILGNSKLKQASLRVLQQLKCCEKRKNLRVT
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp493892TAS2R10taste 2 receptor member 109598VGNC:13476Inparanoid, OMA
Mouse387346Tas2r114taste receptor, type 2, member 11410090MGI:2681218Inparanoid, OMA
Rat78981Tas2r107taste receptor, type 2, member 10710116RGD:620736Inparanoid, OMA
Dog100271734TAS2R10taste 2 receptor member 109615VGNC:47115Inparanoid, OMA
Cow664637BOTA-T2R10Bbitter taste receptor T2R10B9913Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    G-protein coupled receptor    /    Class A rhodopsin like    /    Taste 2 receptor    /    Taste receptor type 2 member 10

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.