🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

UBTD1

DescriptionUbiquitin domain-containing protein 1

Gene and Protein Information

Gene ID80019
Uniprot Accession IDs Q9HAC8 D3DR57 Q53HI3
Ensembl ID ENSP00000359698
Sequence
MGNCVGRQRRERPAAPGHPRKRAGRNEPLKKERLKWKSDYPMTDGQLRSKRDEFWDTAPAFEGRKEIWDALKAAAYAAEANDHELAQAILDGASITLPHGTLCECYDELGNRYQLPIYCLSPPVNLLLEHTEEESLEPPEPPPSVRREFPLKVRLSTGKDVRLSASLPDTVGQLKRQLHAQEGIEPSWQRWFFSGKLLTDRTRLQETKIQKDFVIQVIINQPPPPQD
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp743190UBTD1ubiquitin domain containing 19598VGNC:5870OMA, EggNOG
Mouse226122Ubtd1ubiquitin domain containing 110090MGI:2385092Inparanoid, OMA, EggNOG
Rat309373Ubtd1ubiquitin domain containing 110116RGD:1308172Inparanoid, OMA, EggNOG
Dog486821UBTD1ubiquitin domain containing 19615VGNC:48093Inparanoid, OMA, EggNOG
Horse100070708UBTD1ubiquitin domain containing 19796VGNC:24751Inparanoid, OMA, EggNOG
Cow506002UBTD1ubiquitin domain containing 19913VGNC:36620Inparanoid, OMA, EggNOG
Pig100156395UBTD1ubiquitin domain containing 19823OMA, EggNOG
Anole lizard100567318ubtd1ubiquitin domain containing 128377Inparanoid, OMA, EggNOG
Xenopus448143ubtd1ubiquitin domain containing 18364XB-GENE-993611Inparanoid, OMA
Zebrafish571832ubtd1bubiquitin domain containing 1b7955ZDB-GENE-050913-62OMA, EggNOG
Zebrafish563264ubtd1aubiquitin domain containing 1a7955ZDB-GENE-070424-93Inparanoid, OMA
Fruitfly40647CG1172CG1172 gene product from transcript CG1172-RC7227FBgn0264712Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    ligase    /    ubiquitin-protein ligase    /    Ubiquitin domain-containing protein 1
DTO Classes
protein    /    Enzyme    /    Ligase    /    Ubiquitin-protein ligase    /    Ubiquitin domain-containing protein 1

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.