224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Urokinase plasminogen activator surface receptor |
|---|
Gene and Protein Information
| Gene ID | 5329 |
|---|---|
| Uniprot Accession IDs | Q03405 A8K409 Q12876 Q15845 Q16887 Q6IB52 Q9BWT0 Q9NYC8 Q9UD69 Q9UEA6 Q9UM92 Q9UMV0 U-PAR |
| Ensembl ID | ENSP00000339328 |
| Symbol | MO3 UPAR CD87 UPAR URKR U-PAR |
| Sequence | MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDVQYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 450103 | PLAUR | plasminogen activator, urokinase receptor | 9598 | Inparanoid, OMA, EggNOG | |
| Macaque | 710662 | PLAUR | plasminogen activator, urokinase receptor | 9544 | OMA, EggNOG | |
| Mouse | 18793 | Plaur | plasminogen activator, urokinase receptor | 10090 | MGI:97612 | Inparanoid, OMA, EggNOG |
| Rat | 50692 | Plaur | plasminogen activator, urokinase receptor | 10116 | RGD:620597 | Inparanoid, OMA, EggNOG |
| Horse | 100033904 | PLAUR | plasminogen activator, urokinase receptor | 9796 | VGNC:21531 | Inparanoid, OMA, EggNOG |
| Cow | 281983 | PLAUR | plasminogen activator, urokinase receptor | 9913 | VGNC:32976 | Inparanoid, OMA, EggNOG |
| Anole lizard | 103279307 | LOC103279307 | urokinase plasminogen activator surface receptor | 28377 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.