224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | T-cell leukemia/lymphoma protein 1A |
|---|
Gene and Protein Information
| Gene ID | 8115 |
|---|---|
| Uniprot Accession IDs | P56279 Q6IBK7 |
| Ensembl ID | ENSP00000385036 |
| Symbol | TCL1 TCL1 |
| Family | Belongs to the TCL1 family. |
| Sequence | MAECPTLGEAVTDHPDRLWAWEKFVYLDEKQHAWLPLTIEIKDRLQLRVLLRREDVVLGRPMTPTQIGPSLLPIMWQLYPDGRYRSSDSSFWRLVYHIKIDGVEDMLLELLPDD |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 741380 | TCL1A | T-cell leukemia/lymphoma 1A | 9598 | OMA, EggNOG | |
| Macaque | TCL1A | T cell leukemia/lymphoma 1A [Source:HGNC Symbol;Acc:HGNC:11648] | 9544 | Inparanoid, OMA | ||
| Mouse | 21432 | Tcl1 | T cell lymphoma breakpoint 1 | 10090 | MGI:1097166 | Inparanoid, OMA, EggNOG |
| Rat | 690575 | Tcl1a | T-cell leukemia/lymphoma 1A | 10116 | RGD:1594686 | Inparanoid, OMA, EggNOG |
| Cow | 506540 | TCL1A | T-cell leukemia/lymphoma 1A | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100156364 | TCL1A | T-cell leukemia/lymphoma 1A | 9823 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.