🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TEC

DescriptionTyrosine-protein kinase Tec

Gene and Protein Information

Gene ID7006
Uniprot Accession IDs P42680 B7ZKZ6 Q3MIS5
Ensembl ID ENSP00000370912
Symbol PSCTK4 PSCTK4
FamilyBelongs to the protein kinase superfamily. Tyr protein kinase family. TEC subfamily.
Sequence
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSMLTYYEGRAEKKYRKGFIDVSKIKCVEIVKNDDGVIPCQNKYPFQVVHDANTLYIFAPSPQSRDLWVKKLKEEIKNNNNIMIKYHPKFWTDGSYQCCRQTEKLAPGCEKYNLFESSIRKALPPAPETKKRRPPPPIPLEEEDNSEEIVVAMYDFQAAEGHDLRLERGQEYLILEKNDVHWWRARDKYGNEGYIPSNYVTGKKSNNLDQYEWYCRNMNRSKAEQLLRSEDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYHIKETTTSPKKYYLAEKHAFGSIPEIIEYHKHNAAGLVTRLRYPVSVKGKNAPTTAGFSYEKWEINPSELTFMRELGSGLFGVVRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTEFMERGCLLNFLRQRQGHFSRDVLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVSEAGVVKVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEVFTEGRMPFEKYTNYEVVTMVTRGHRLYQPKLASNYVYEVMLRCWQEKPEGRPSFEDLLRTIDELVECEETFGR
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp461343TECtec protein tyrosine kinase9598VGNC:732OMA, EggNOG
Macaque705357TECtec protein tyrosine kinase9544Inparanoid, OMA, EggNOG
Mouse21682Tectec protein tyrosine kinase10090MGI:98662Inparanoid, OMA, EggNOG
Rat84492Tectec protein tyrosine kinase10116RGD:620973Inparanoid, OMA, EggNOG
Dog482140TECtec protein tyrosine kinase9615VGNC:47231Inparanoid, OMA, EggNOG
Horse100061381TECtec protein tyrosine kinase9796VGNC:23982Inparanoid, OMA, EggNOG
Cow504733TECtec protein tyrosine kinase9913VGNC:35728Inparanoid, OMA, EggNOG
Pig404277TECtec protein tyrosine kinase9823Inparanoid, OMA
Opossum100019245TECtec protein tyrosine kinase13616Inparanoid, OMA, EggNOG
Chicken396407TECtec protein tyrosine kinase9031CGNC:10536Inparanoid, OMA
Anole lizard100563819tectec protein tyrosine kinase28377Inparanoid, OMA
Xenopus100491653tectec protein tyrosine kinase8364XB-GENE-6076361Inparanoid, OMA
Zebrafish571588tectec protein tyrosine kinase7955ZDB-GENE-030131-7499Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Kinase    /    Protein kinase    /    TK group    /    TEC family    /    Tyrosine-protein kinase tec

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.