224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Transcription elongation factor A protein-like 6 |
|---|
Gene and Protein Information
| Gene ID | 158931 |
|---|---|
| Uniprot Accession IDs | Q6IPX3 Q5H9J8 TCEA-like protein 6 |
| Ensembl ID | ENSP00000361860 |
| Symbol | WEX2 Tceal3 |
| Family | Belongs to the TFS-II family. TFA subfamily. |
| Sequence | MEKPYNKNEGNLENEGKPEDEVEPDDEGKSDEEEKPDAEGKTECEGKRKAEGEPGDEGQLEDKGSQEKQGKSEGEGKPQGEGKPASQAKPEGQPRAAEKRPAGDYVPRKAKRKTDRGTDDSPKDSQEDLQERHLSSEEMMRECGDVSRAQEELRKKQKMGGFHWMQRDVQDPFAPRGQRGVRGVRGGGRGQRGLHDIPYL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 594844 | Tceal3 | transcription elongation factor A (SII)-like 3 | 10090 | MGI:1913354 | Inparanoid, OMA |
| Dog | 100688010 | LOC100688010 | transcription elongation factor A protein-like 3 | 9615 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.