🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TFF2

DescriptionTrefoil factor 2

Gene and Protein Information

Gene ID7032
Uniprot Accession IDs Q03403 Q15854
Ensembl ID ENSP00000291526
Symbol SML1 SP SML1
Sequence
MGRRDAQLLAALLVLGLCALAGSEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSVTGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIFEVPWCFFPKSVEDCHY
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp470096TFF2trefoil factor 29598VGNC:1119OMA, EggNOG
Macaque714550TFF2trefoil factor 29544OMA, EggNOG
Mouse21785Tff2trefoil factor 2 (spasmolytic protein 1)10090MGI:1306805Inparanoid, OMA, EggNOG
Rat116592Tff2trefoil factor 210116RGD:620709Inparanoid, OMA, EggNOG
Dog403489TFF2trefoil factor 29615VGNC:47297Inparanoid, OMA, EggNOG
Horse100051351TFF2trefoil factor 29796VGNC:24042Inparanoid, OMA, EggNOG
Cow616105TFF2trefoil factor 29913VGNC:35791Inparanoid, OMA, EggNOG
Pig397420TFF2trefoil factor 29823Inparanoid, OMA, EggNOG
Opossum103100901TFF2trefoil factor 213616Inparanoid, OMA, EggNOG
Chicken418534TFF2trefoil factor 29031CGNC:50784Inparanoid, OMA, EggNOG
Anole lizard107982585LOC107982585trefoil factor 2-like28377OMA, EggNOG
Xenopus100496501tff2trefoil factor 28364XB-GENE-5824118Inparanoid, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    peptide hormone    /    Trefoil factor 2
protein    /    signaling molecule    /    growth factor    /    Trefoil factor 2
DTO Classes
protein    /    Signaling    /    Growth factor    /    Trefoil factor 2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.