TPD52L2

DescriptionTumor protein D54

Gene and Protein Information

Gene ID7165
Uniprot Accession IDs O43399 B4DPJ6 E1P5G7 O43398 Q5JWU5 Q5JWU6 Q5JWU8 Q5U0E0 Q9H3Z6 hD54
Ensembl ID ENSP00000217121
Symbol D54 TPD54
FamilyBelongs to the TPD52 family.
Sequence
MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp458458TPD52L2tumor protein D52 like 29598OMA, EggNOG
Mouse66314Tpd52l2tumor protein D52-like 210090MGI:1913564Inparanoid, OMA, EggNOG
Rat296480Tpd52l2tumor protein D52-like 210116RGD:735167Inparanoid, OMA, EggNOG
Dog610715TPD52L2tumor protein D52 like 29615VGNC:47735Inparanoid, OMA, EggNOG
Horse100060965TPD52L2tumor protein D52 like 29796Inparanoid, OMA, EggNOG
Cow534704TPD52L2tumor protein D52 like 29913VGNC:36246Inparanoid, OMA, EggNOG
Chicken419257TPD52L2tumor protein D52 like 29031CGNC:50951Inparanoid, OMA, EggNOG
Anole lizard100567261tpd52l2tumor protein D52 like 228377OMA, EggNOG
Zebrafish322103tpd52l2btumor protein D52-like 2b7955ZDB-GENE-030131-822Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.