TGIF2

DescriptionHomeobox protein TGIF2

Gene and Protein Information

Gene ID60436
Uniprot Accession IDs Q9GZN2 B2R9U3 E1P5T9 H0YNI0
Ensembl ID ENSP00000362981
FamilyBelongs to the TALE/TGIF homeobox family.
Sequence
MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp101057323TGIF2TGFB induced factor homeobox 29598VGNC:10009OMA, EggNOG
Rat499929Tgif2TGFB-induced factor homeobox 210116RGD:1560115OMA, EggNOG
Dog485857TGIF2TGFB induced factor homeobox 29615VGNC:47314Inparanoid, OMA, EggNOG
Horse102149210TGIF2TGFB induced factor homeobox 29796VGNC:24059Inparanoid, OMA, EggNOG
Cow535632TGIF2TGFB induced factor homeobox 29913VGNC:35808Inparanoid, OMA, EggNOG
Opossum103092287TGIF2TGFB induced factor homeobox 213616Inparanoid, EggNOG
PlatypusTGIF2TGFB induced factor homeobox 2 [Source:HGNC Symbol;Acc:HGNC:15764]9258OMA, EggNOG
Chicken428131TGIF2TGFB induced factor homeobox 29031CGNC:53278OMA, EggNOG
Anole lizard100565304LOC100565304homeobox protein TGIF228377OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    RNA binding protein    /    homeodomain transcription factor    /    Homeobox protein TGIF2
protein    /    RNA binding protein    /    DNA-directed RNA polymerase    /    Homeobox protein TGIF2
DTO Classes
protein    /    Enzyme    /    Transferase    /    Nucleotidyltransferase    /    Polymerase    /    DNA-directed RNA polymerase    /    Homeobox protein TGIF2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.