🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

TGIF2

DescriptionHomeobox protein TGIF2

Gene and Protein Information

Gene ID60436
Uniprot Accession IDs Q9GZN2 B2R9U3 E1P5T9 H0YNI0
Ensembl ID ENSP00000362981
FamilyBelongs to the TALE/TGIF homeobox family.
Sequence
MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQEKLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKASDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGELESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQLLVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp101057323TGIF2TGFB induced factor homeobox 29598VGNC:10009OMA, EggNOG
Rat499929Tgif2TGFB-induced factor homeobox 210116RGD:1560115OMA, EggNOG
Dog485857TGIF2TGFB induced factor homeobox 29615VGNC:47314Inparanoid, OMA, EggNOG
Horse102149210TGIF2TGFB induced factor homeobox 29796VGNC:24059Inparanoid, OMA, EggNOG
Cow535632TGIF2TGFB induced factor homeobox 29913VGNC:35808Inparanoid, OMA, EggNOG
Opossum103092287TGIF2TGFB induced factor homeobox 213616Inparanoid, EggNOG
PlatypusTGIF2TGFB induced factor homeobox 2 [Source:HGNC Symbol;Acc:HGNC:15764]9258OMA, EggNOG
Chicken428131TGIF2TGFB induced factor homeobox 29031CGNC:53278OMA, EggNOG
Anole lizard100565304LOC100565304homeobox protein TGIF228377OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    RNA binding protein    /    homeodomain transcription factor    /    Homeobox protein TGIF2
protein    /    RNA binding protein    /    DNA-directed RNA polymerase    /    Homeobox protein TGIF2
DTO Classes
protein    /    Enzyme    /    Transferase    /    Nucleotidyltransferase    /    Polymerase    /    DNA-directed RNA polymerase    /    Homeobox protein TGIF2

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.