The store will not work correctly when cookies are disabled.
JavaScript seems to be disabled in your browser. For the best experience on our site, be sure to turn on Javascript in your browser.
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
TXN Gene and Protein Information Gene ID 7295 Uniprot Accession IDs P10599 B1ALW1 O60744 Q53X69 Q96KI3 Q9UDG5 Trx Ensembl ID ENSP00000363641 Symbol TRDX TRX TRX1 TRX TRDX TRX1 Family Belongs to the thioredoxin family. Sequence MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV
Homologous gene and protein info.
Species Gene ID Gene Symbol Name Tax ID Other Gene ID Sources Chimp 740248 TXN thioredoxin 9598 VGNC:4894 OMA, EggNOG Macaque 712587 TXN thioredoxin 9544 Inparanoid, OMA, EggNOG Mouse 22166 Txn1 thioredoxin 1 10090 MGI:98874 Inparanoid, OMA, EggNOG Rat 116484 Txn1 thioredoxin 1 10116 RGD:621157 OMA, EggNOG Horse 100033827 TXN thioredoxin 9796 Inparanoid, OMA, EggNOG Cow 280950 TXN thioredoxin 9913 Inparanoid, OMA, EggNOG Pig 397581 TXN thioredoxin 9823 Inparanoid, OMA, EggNOG Platypus 100076650 LOC100076650 thioredoxin-like 9258 Inparanoid, OMA, EggNOG Chicken 396437 TXN thioredoxin 9031 CGNC:49804 Inparanoid, OMA, EggNOG Anole lizard 100560936 LOC100560936 thioredoxin 28377 OMA, EggNOG Xenopus 100170420 loc100170420 MGC80314 protein 8364 XB-GENE-5909791 Inparanoid, OMA, EggNOG Zebrafish 336637 zgc:56493 zgc:56493 7955 ZDB-GENE-030131-8581 Inparanoid, OMA, EggNOG C. elegans 189905 trx-4 Thioredoxin 6239 OMA, EggNOG S.cerevisiae 850732 TRX1 thioredoxin TRX1 4932 S000004033 Inparanoid, OMA
Associated Recombinant Proteins Name Specification and purity Expression system Protein label Availability View Details
Associated Antibodies
Name Specifications Species reactivity Application Availability View Details
Associated Approved Drugs Associated Active Ligands Associated Diseases Name Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Settings Agree All Decline
Shall we send you a message when we have discounts available?
Remind me later Allow
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.