🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

THRSP

DescriptionThyroid hormone-inducible hepatic protein

Gene and Protein Information

Gene ID7069
Uniprot Accession IDs Q92748 B2R4W7
Ensembl ID ENSP00000281030
Symbol S14 Lpgp THRP LPGP1 SPOT14
FamilyBelongs to the SPOT14 family.
Sequence
MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp466721THRSPthyroid hormone responsive9598VGNC:987OMA, EggNOG
Macaque699701THRSPthyroid hormone responsive9544Inparanoid, OMA, EggNOG
Mouse21835Thrspthyroid hormone responsive10090MGI:109126Inparanoid, OMA, EggNOG
Rat25357Thrspthyroid hormone responsive10116RGD:3859Inparanoid, OMA, EggNOG
Dog485169THRSPthyroid hormone responsive9615VGNC:47356Inparanoid, OMA, EggNOG
Horse100051297THRSPthyroid hormone responsive9796VGNC:24091Inparanoid, OMA, EggNOG
Cow515940THRSPthyroid hormone responsive9913VGNC:35848Inparanoid, OMA, EggNOG
Opossum100027353THRSPthyroid hormone responsive13616Inparanoid, OMA, EggNOG
Anole lizard100567607LOC100567607thyroid hormone-inducible hepatic protein-like28377Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.