224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Transcriptional enhancer factor TEF-3 |
|---|
Gene and Protein Information
| Gene ID | 7004 |
|---|---|
| Uniprot Accession IDs | Q15561 H0Y308 Q6MZR9 Q8NEV5 Q92883 Q96BK2 |
| Ensembl ID | ENSP00000352926 |
| Symbol | RTEF1 TCF13L1 TEF3 TEF3 RTEF1 TEF-3 EFTR-2 TEFR-1 TCF13L1 hRTEF-1B |
| Sequence | MEGTAGTITSNEWSSPTSPEGSTASGGSQALDKPIDNDAEGVWSPDIEQSFQEALAIYPPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKAREIQAKLKDQAAKDKALQSMAAMSSAQIISATAFHSSMALARGPGRPAVSGFWQGALPGQAGTSHDVKPFSQQTYAVQPPLPLPGFESPAGPAPSPSAPPAPPWQGRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFPEKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVCSFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTILQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 451756 | TEAD4 | TEA domain transcription factor 4 | 9598 | VGNC:5617 | OMA, EggNOG |
| Mouse | 21679 | Tead4 | TEA domain family member 4 | 10090 | MGI:106907 | Inparanoid, OMA, EggNOG |
| Rat | 683522 | Tead4 | TEA domain transcription factor 4 | 10116 | RGD:1585671 | OMA, EggNOG |
| Dog | TEAD4 | TEA domain transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:11717] | 9615 | OMA, EggNOG | ||
| Horse | 100057619 | TEAD4 | TEA domain transcription factor 4 | 9796 | VGNC:23981 | Inparanoid, OMA, EggNOG |
| Cow | 526771 | TEAD4 | TEA domain transcription factor 4 | 9913 | VGNC:35727 | Inparanoid, OMA, EggNOG |
| Pig | 100152085 | TEAD4 | TEA domain transcription factor 4 | 9823 | Inparanoid, OMA, EggNOG | |
| Opossum | TEAD4 | TEA domain transcription factor 4 [Source:HGNC Symbol;Acc:HGNC:11717] | 13616 | Inparanoid, OMA, EggNOG | ||
| Chicken | 395542 | TEAD4 | TEA domain transcription factor 4 | 9031 | CGNC:49367 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.