🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

EYA2

DescriptionEyes absent homolog 2

Gene and Protein Information

Gene ID2139
Uniprot Accession IDs O00167 Q5JSW8 Q86U84 Q96CV6 Q96H97 Q99503 Q99812 Q9BWF6 Q9H4S3 Q9H4S9 Q9NPZ4 Q9UIX7
Ensembl ID ENSP00000333640
Symbol EAB1 EAB1
FamilyBelongs to the HAD-like hydrolase superfamily. EYA family.
Sequence
MVELVISPSLTVNSDCLDKLKFNRADAAVWTLSDRQGITKSAPLRVSQLFSRSCPRVLPRQPSTAMAAYGQTQYSAGIQQATPYTAYPPPAQAYGIPSYSIKTEDSLNHSPGQSGFLSYGSSFSTSPTGQSPYTYQMHGTTGFYQGGNGLGNAAGFGSVHQDYPSYPGFPQSQYPQYYGSSYNPPYVPASSICPSPLSTSTYVLQEASHNVPNQSSESLAGEYNTHNGPSTPAKEGDTDRPHRASDGKLRGRSKRSSDPSPAGDNEIERVFVWDLDETIIIFHSLLTGTFASRYGKDTTTSVRIGLMMEEMIFNLADTHLFFNDLEDCDQIHVDDVSSDDNGQDLSTYNFSADGFHSSAPGANLCLGSGVHGGVDWMRKLAFRYRRVKEMYNTYKNNVGGLIGTPKRETWLQLRAELEALTDLWLTHSLKALNLINSRPNCVNVLVTTTQLIPALAKVLLYGLGSVFPIENIYSATKTGKESCFERIMQRFGRKAVYVVIGDGVEEEQGAKKHNMPFWRISCHADLEALRHALELEYL
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp458305EYA2EYA transcriptional coactivator and phosphatase 29598VGNC:9856OMA, EggNOG
Macaque716182EYA2EYA transcriptional coactivator and phosphatase 29544Inparanoid, OMA, EggNOG
Mouse14049Eya2EYA transcriptional coactivator and phosphatase 210090MGI:109341Inparanoid, OMA, EggNOG
Rat156826Eya2EYA transcriptional coactivator and phosphatase 210116RGD:620096Inparanoid, OMA, EggNOG
Dog609926EYA2EYA transcriptional coactivator and phosphatase 29615VGNC:40537Inparanoid, OMA, EggNOG
Horse100071250EYA2EYA transcriptional coactivator and phosphatase 29796VGNC:17746Inparanoid, OMA, EggNOG
Cow615264EYA2EYA transcriptional coactivator and phosphatase 29913VGNC:28671Inparanoid, OMA, EggNOG
Pig100624872EYA2EYA transcriptional coactivator and phosphatase 29823OMA, EggNOG
Opossum100023574EYA2EYA transcriptional coactivator and phosphatase 213616Inparanoid, EggNOG
Platypus100074653EYA2EYA transcriptional coactivator and phosphatase 29258Inparanoid, OMA, EggNOG
Chicken107054875EYA2EYA transcriptional coactivator and phosphatase 29031CGNC:77843Inparanoid, OMA, EggNOG
Anole lizard100558675eya2EYA transcriptional coactivator and phosphatase 228377Inparanoid, OMA, EggNOG
Xenopus100037919eya2EYA transcriptional coactivator and phosphatase 28364XB-GENE-487844Inparanoid, OMA, EggNOG
Zebrafish447819eya2EYA transcriptional coactivator and phosphatase 27955ZDB-GENE-040912-24OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.