224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Protein SET |
|---|
Gene and Protein Information
| Gene ID | 6418 |
|---|---|
| Uniprot Accession IDs | Q01105 A5A5H4 A6NGV1 B4DUE2 Q15541 Q5VXV1 Q5VXV2 Q6FHZ5 |
| Ensembl ID | ENSP00000361777 |
| Symbol | 2PP2A IGAAD MRD58 TAF-I I2PP2A IPP2A2 PHAPII TAF-IBETA |
| Family | Belongs to the nucleosome assembly protein (NAP) family. |
| Sequence | MAPKRQSPLPPQKKKPRPPPALGPEETSASAGLPKKGEKEQQEAIEHIDEVQNEIDRLNEQASEEILKVEQKYNKLRQPFFQKRSELIAKIPNFWVTTFVNHPQVSALLGEEDEEALHYLTRVEVTEFEDIKSGYRIDFYFDENPYFENKVLSKEFHLNESGDPSSKSTEIKWKSGKDLTKRSSQTQNKASRKRQHEEPESFFTWFTDHSDAGADELGEVIKDDIWPNPLQYYLVPDMDDEEGEGEEDDDDDEEEEGLEDIDEEGDEDEGEEDEDDDEGEEGEEDEGEDD |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 100613143 | SET | SET nuclear proto-oncogene | 9598 | VGNC:4860 | OMA, EggNOG |
| Macaque | 693242 | SET | SET nuclear proto-oncogene | 9544 | OMA, EggNOG | |
| Mouse | 56086 | Set | SET nuclear oncogene | 10090 | MGI:1860267 | Inparanoid, OMA, EggNOG |
| Rat | 307947 | Set | SET nuclear proto-oncogene | 10116 | RGD:1307467 | OMA, EggNOG |
| Rat | 296619 | Pkn3 | protein kinase N3 | 10116 | RGD:1305921 | Inparanoid, OMA |
| Dog | 608952 | SET | SET nuclear proto-oncogene | 9615 | OMA, EggNOG | |
| Horse | 100066929 | SET | SET nuclear proto-oncogene | 9796 | Inparanoid, OMA, EggNOG | |
| Cow | 538444 | SET | SET nuclear proto-oncogene | 9913 | Inparanoid, OMA, EggNOG | |
| Pig | 100514028 | SET | SET nuclear proto-oncogene | 9823 | Inparanoid, OMA, EggNOG | |
| Chicken | 417210 | SET | SET nuclear proto-oncogene | 9031 | CGNC:3483 | Inparanoid, OMA, EggNOG |
| Xenopus | 394638 | set | SET nuclear proto-oncogene | 8364 | XB-GENE-986872 | Inparanoid, OMA, EggNOG |
| Zebrafish | 321714 | setb | SET nuclear proto-oncogene b | 7955 | ZDB-GENE-030131-433 | Inparanoid, OMA, EggNOG |
| C. elegans | 177704 | spr-2 | Suppressor of PResenilin defect | 6239 | Inparanoid, OMA, EggNOG | |
| Fruitfly | 41844 | Set | CG4299 gene product from transcript CG4299-RA | 7227 | FBgn0014879 | Inparanoid, OMA, EggNOG |
Protein Classes
PANTHER Classes
protein / enzyme modulator / phosphatase inhibitor / Protein SET
protein / enzyme modulator / chaperone / Protein SET
protein / enzyme modulator / phosphatase inhibitor / Protein SET
protein / enzyme modulator / chaperone / Protein SET
DTO Classes
protein / Enzyme modulator / Phosphatase modulator / Phosphatase inhibitor / Protein SET
protein / Enzyme modulator / Phosphatase modulator / Phosphatase inhibitor / Protein SET
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.