🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

SNRPD3

DescriptionSmall nuclear ribonucleoprotein Sm D3

Gene and Protein Information

Gene ID6634
Uniprot Accession IDs P62318 B4DJP7 B5BU13 P43331 Sm-D3
Ensembl ID ENSP00000215829
Symbol SMD3 Sm-D3
FamilyBelongs to the snRNP core protein family.
Sequence
MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNAPMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp100611816SNRPD3small nuclear ribonucleoprotein D3 polypeptide9598VGNC:6007OMA, EggNOG
Macaque708594SNRPD3small nuclear ribonucleoprotein D3 polypeptide9544Inparanoid, OMA, EggNOG
Mouse67332Snrpd3small nuclear ribonucleoprotein D310090MGI:1914582Inparanoid, OMA, EggNOG
Dog607772SNRPD3small nuclear ribonucleoprotein D3 polypeptide9615Inparanoid, OMA, EggNOG
Horse100050121SNRPD3small nuclear ribonucleoprotein D3 polypeptide9796VGNC:23400Inparanoid, OMA, EggNOG
Cow617823SNRPD3small nuclear ribonucleoprotein D3 polypeptide9913VGNC:35080Inparanoid, OMA, EggNOG
Pig100153480SNRPD3small nuclear ribonucleoprotein D3 polypeptide9823Inparanoid, OMA, EggNOG
Opossum100013096SNRPD3small nuclear ribonucleoprotein D3 polypeptide13616Inparanoid, OMA, EggNOG
Platypus100080137SNRPD3small nuclear ribonucleoprotein D3 polypeptide9258Inparanoid, OMA, EggNOG
Chicken416947SNRPD3small nuclear ribonucleoprotein D3 polypeptide9031CGNC:4974Inparanoid, OMA, EggNOG
Anole lizard100553808snrpd3small nuclear ribonucleoprotein D3 polypeptide28377Inparanoid, OMA, EggNOG
Xenopus549847snrpd3small nuclear ribonucleoprotein D3 polypeptide8364XB-GENE-1014502Inparanoid, OMA, EggNOG
Zebrafish327011snrpd3lsmall nuclear ribonucleoprotein D3 polypeptide, like7955ZDB-GENE-030131-5219Inparanoid, OMA
C. elegans178483snr-1Small nuclear ribonucleoprotein Sm D36239Inparanoid, OMA
Fruitfly36306SmD3Small ribonucleoprotein particle protein SmD37227FBgn0023167Inparanoid, EggNOG
S.cerevisiae850839SMD3mRNA splicing protein SMD34932S000004137Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    ribonucleoprotein    /    Small nuclear ribonucleoprotein Sm D3
protein    /    nucleic acid binding    /    mRNA splicing factor    /    Small nuclear ribonucleoprotein Sm D3
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    mRNA processing factor    /    mRNA splicing factor    /    Small nuclear ribonucleoprotein Sm D3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.