224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Secreted frizzled-related protein 1 |
|---|
Gene and Protein Information
| Gene ID | 6422 |
|---|---|
| Uniprot Accession IDs | Q8N474 O00546 O14779 FRP-1 |
| Ensembl ID | ENSP00000220772 |
| Symbol | FRP FRP1 SARP2 FRP FRP1 FrzA FRP-1 SARP2 |
| Family | Belongs to the secreted frizzled-related protein (sFRP) family. |
| Sequence | MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPLLNKNCHAGTQVFLCSLFAPVCLDRPIYPCRWLCEAVRDSCEPVMQFFGFYWPEMLKCDKFPEGDVCIAMTPPNATEASKPQGTTVCPPCDNELKSEAIIEHLCASEFALRMKIKEVKKENGDKKIVPKKKKPLKLGPIKKKDLKKLVLYLKNGADCPCHQLDNLSHHFLIMGRKVKSQYLLTAIHKWDKKNKEFKNFMKKMKNHECPTFQSVFK Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 736186 | SFRP1 | secreted frizzled related protein 1 | 9598 | VGNC:10329 | OMA, EggNOG |
| Macaque | 702876 | SFRP1 | secreted frizzled related protein 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 20377 | Sfrp1 | secreted frizzled-related protein 1 | 10090 | MGI:892014 | Inparanoid, OMA, EggNOG |
| Rat | 84402 | Sfrp1 | secreted frizzled-related protein 1 | 10116 | RGD:621074 | OMA, EggNOG |
| Dog | 482844 | SFRP1 | secreted frizzled related protein 1 | 9615 | VGNC:46080 | Inparanoid, OMA, EggNOG |
| Horse | SFRP1 | secreted frizzled related protein 1 [Source:HGNC Symbol;Acc:HGNC:10776] | 9796 | OMA, EggNOG | ||
| Cow | 282068 | SFRP1 | secreted frizzled related protein 1 | 9913 | VGNC:34520 | Inparanoid, OMA, EggNOG |
| Opossum | 100033009 | SFRP1 | secreted frizzled related protein 1 | 13616 | Inparanoid, EggNOG | |
| Chicken | 395237 | SFRP1 | secreted frizzled related protein 1 | 9031 | CGNC:2531 | Inparanoid, OMA, EggNOG |
| Xenopus | 100038100 | sfrp1 | secreted frizzled-related protein 1 | 8364 | XB-GENE-488230 | Inparanoid, OMA, EggNOG |
| Zebrafish | 402843 | sfrp1a | secreted frizzled-related protein 1a | 7955 | ZDB-GENE-040310-5 | OMA, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.