224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Protein SGT1 homolog |
|---|
Gene and Protein Information
| Gene ID | 10910 |
|---|---|
| Uniprot Accession IDs | Q9Y2Z0 A2A303 Q5JAK5 Q5TAM6 Q6VXY6 |
| Ensembl ID | ENSP00000367208 |
| Symbol | SGT1 |
| Family | Belongs to the SGT1 family. |
| Sequence | MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDIETGFHRVGQAGLQLLTSSDPPALDSQSAGITGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 452744 | SUGT1 | SGT1 homolog, MIS12 kinetochore complex assembly cochaperone | 9598 | VGNC:7304 | Inparanoid, OMA, EggNOG |
| Macaque | 694046 | SUGT1 | SGT1 homolog, MIS12 kinetochore complex assembly cochaperone | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 67955 | Sugt1 | SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) | 10090 | MGI:1915205 | Inparanoid, OMA, EggNOG |
| Rat | 290408 | Sugt1 | SGT1 homolog, MIS12 kinetochore complex assembly cochaperone | 10116 | RGD:1307550 | Inparanoid, OMA, EggNOG |
| Horse | 100051549 | SUGT1 | SGT1 homolog, MIS12 kinetochore complex assembly cochaperone | 9796 | VGNC:23752 | Inparanoid, OMA, EggNOG |
| Cow | 515509 | SUGT1 | SGT1 homolog, MIS12 kinetochore complex assembly cochaperone | 9913 | VGNC:35465 | Inparanoid, OMA, EggNOG |
| Chicken | 418827 | SUGT1 | SGT1 homolog, MIS12 kinetochore complex assembly cochaperone | 9031 | CGNC:12721 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100552516 | sugt1 | SGT1 homolog, MIS12 kinetochore complex assembly cochaperone | 28377 | Inparanoid, OMA, EggNOG | |
| Xenopus | 548910 | sugt1 | SGT1 homolog, MIS12 kinetochore complex assembly cochaperone | 8364 | XB-GENE-919559 | Inparanoid, OMA, EggNOG |
| Fruitfly | 40982 | Sgt1 | suppressor-of-G2-allele-of-skp1 | 7227 | FBgn0265101 | Inparanoid, EggNOG |
| S.cerevisiae | 854222 | SGT1 | co-chaperone SGT1 | 4932 | S000005583 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.