224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Phytanoyl-CoA dioxygenase domain-containing protein 1 |
|---|
Gene and Protein Information
| Gene ID | 254295 |
|---|---|
| Uniprot Accession IDs | Q5SRE7 A6PWN9 A6PWP0 B3KT57 B4E3X8 Q5SRE9 Q5SRF0 Q7Z623 Q7Z7P9 Q96GM4 |
| Ensembl ID | ENSP00000309515 |
| Family | Belongs to the PhyH family. PHYHD1 subfamily. |
| Sequence | MACLSPSQLQKFQQDGFLVLEGFLSAEECVAMQQRIGEIVAEMDVPLHCRTEFSTQEEEQLRAQGSTDYFLSSGDKIRFFFEKGVFDEKGNFLVPPEKSINKIGHALHAHDPVFKSITHSFKVQTLARSLGLQMPVVVQSMYIFKQPHFGGEVSPHQDASFLYTEPLGRVLGVWIAVEDATLENGCLWFIPGSHTSGVSRRMVRAPVGSAPGTSFLGSEPARDNSLFVPTPVQRGALVLIHGEVVHKSKQNLSDRSRQAYTFHLMEASGTTWSPENWLQPTAELPFPQLYT |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 464911 | PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 | 9598 | VGNC:4820 | OMA, EggNOG |
| Macaque | 717104 | PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 227696 | Phyhd1 | phytanoyl-CoA dioxygenase domain containing 1 | 10090 | MGI:3612860 | Inparanoid, EggNOG |
| Rat | 296621 | Phyhd1 | phytanoyl-CoA dioxygenase domain containing 1 | 10116 | RGD:1310377 | Inparanoid, EggNOG |
| Dog | 608889 | PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 | 9615 | Inparanoid, EggNOG | |
| Cow | 540828 | PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 | 9913 | Inparanoid, EggNOG | |
| Pig | 110255203 | PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 | 9823 | Inparanoid, EggNOG | |
| Opossum | 100013766 | PHYHD1 | phytanoyl-CoA dioxygenase domain containing 1 | 13616 | Inparanoid, EggNOG | |
| Xenopus | 100135401 | phyhd1 | phytanoyl-CoA dioxygenase domain containing 1 | 8364 | XB-GENE-966497 | Inparanoid, EggNOG |
| Zebrafish | 492804 | phyhd1 | phytanoyl-CoA dioxygenase domain containing 1 | 7955 | ZDB-GENE-041114-159 | Inparanoid, EggNOG |
| C. elegans | 178445 | Y105C5B.9 | Phytanoyl-CoA dioxygenase domain-containing protein 1 homolog | 6239 | Inparanoid, EggNOG | |
| Fruitfly | 41275 | CG14688 | CG14688 gene product from transcript CG14688-RB | 7227 | FBgn0037819 | Inparanoid, EggNOG |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.