PAX5

DescriptionPaired box protein Pax-5

Gene and Protein Information

Gene ID5079
Uniprot Accession IDs Q02548 A3QVP6 A3QVP7 A3QVP8 C0KTF6 C0KTF7 C0KTF8 C0KTF9 C0KTG0 O75933 Q5SFM2 Q6S728 Q6S729 Q6S730 Q6S731 Q6S732
Ensembl ID ENSP00000350844
Symbol ALL3 BSAP
Sequence
MDLEKNYPTPRTSRTGHGGVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKILGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRLLAERVCDNDTVPSVSSINRIIRTKVQQPPNQPVPASSHSIVSTGSVTQVSSVSTDSAGSSYSISGILGITSPSADTNKRKRDEGIQESPVPNGHSLPGRDFLRKQMRGDLFTQQQLEVLDRVFERQHYSDIFTTTEPIKPEQTTEYSAMASLAGGLDDMKANLASPTPADIGSSVPGPQSYPIVTGRDLASTTLPGYPPHVPPAGQGSYSAPTLTGMVPGSEFSGSPYSHPQYSSYNDSWRFPNPGLLGSPYYYSAAARGAAPPAAATAYDRH
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp747452PAX5paired box 59598VGNC:13933OMA, EggNOG
Macaque716839PAX5paired box 59544OMA, EggNOG
Mouse18507Pax5paired box 510090MGI:97489Inparanoid, OMA, EggNOG
Rat500453Pax5paired box 510116RGD:1565236Inparanoid, OMA
Dog612021PAX5paired box 59615VGNC:44278Inparanoid, OMA, EggNOG
Horse100055252PAX5paired box 59796VGNC:21177Inparanoid, OMA, EggNOG
Opossum100013303PAX5paired box 513616Inparanoid, OMA, EggNOG
Platypus100078238PAX5paired box 59258Inparanoid, OMA, EggNOG
Chicken387330PAX5paired box 59031CGNC:49160Inparanoid, OMA
Anole lizard100555546pax5paired box 528377Inparanoid, OMA, EggNOG
Xenopus100493222pax5paired box 58364XB-GENE-479876Inparanoid, OMA
Zebrafish60636pax5paired box 57955ZDB-GENE-001030-2Inparanoid, OMA

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.