🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

SORD

DescriptionSorbitol dehydrogenase

Gene and Protein Information

Gene ID6652
Uniprot Accession IDs Q00796 B2R655 B7Z3A6 J3JZZ5 Q16682 Q9UMD6
Ensembl ID ENSP00000267814
Symbol SORD1 HEL-S-95n
FamilyBelongs to the zinc-containing alcohol dehydrogenase family.
Sequence
MAAAAKPNNLSLVVHGPGDLRLENYPIPEPGPNEVLLRMHSVGICGSDVHYWEYGRIGNFIVKKPMVLGHEASGTVEKVGSSVKHLKPGDRVAIEPGAPRENDEFCKMGRYNLSPSIFFCATPPDDGNLCRFYKHNAAFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGHKVLVCGAGPIGMVTLLVAKAMGAAQVVVTDLSATRLSKAKEIGADLVLQISKESPQEIARKVEGQLGCKPEVTIECTGAEASIQAGIYATRSGGNLVLVGLGSEMTTVPLLHAAIREVDIKGVFRYCNTWPVAISMLASKSVNVKPLVTHRFPLEKALEAFETFKKGLGLKIMLKCDPSDQNP
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp453394SORDsorbitol dehydrogenase9598VGNC:13426OMA, EggNOG
Macaque712784SORDsorbitol dehydrogenase9544Inparanoid, OMA, EggNOG
Mouse20322Sordsorbitol dehydrogenase10090MGI:98266Inparanoid, OMA, EggNOG
Dog487535SORDsorbitol dehydrogenase9615VGNC:46662Inparanoid, OMA, EggNOG
Horse100070575SORDsorbitol dehydrogenase9796VGNC:23451Inparanoid, OMA, EggNOG
Cow508954SORDsorbitol dehydrogenase9913VGNC:35131Inparanoid, OMA, EggNOG
Pig100158181SORDsorbitol dehydrogenase9823OMA, EggNOG
Opossum100012620SORDsorbitol dehydrogenase13616Inparanoid, EggNOG
Platypus100087927LOC100087927sorbitol dehydrogenase-like9258Inparanoid, EggNOG
Anole lizard100562847LOC100562847sorbitol dehydrogenase28377OMA, EggNOG
Xenopus496715sordsorbitol dehydrogenase8364XB-GENE-1005865Inparanoid, OMA, EggNOG
Zebrafish570613sordsorbitol dehydrogenase7955ZDB-GENE-040426-1231Inparanoid, OMA, EggNOG
C. elegans179405R04B5.5hypothetical protein6239OMA, EggNOG
S.cerevisiae851351SOR2L-iditol 2-dehydrogenase SOR24932S000002405Inparanoid, OMA
S.cerevisiae853624SOR1L-iditol 2-dehydrogenase SOR14932S000003920OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    dehydrogenase    /    Sorbitol dehydrogenase
protein    /    oxidoreductase    /    reductase    /    Sorbitol dehydrogenase
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Dehydrogenase    /    Sorbitol dehydrogenase

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.