🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

PRDX4

DescriptionPeroxiredoxin-4

Gene and Protein Information

Gene ID10549
Uniprot Accession IDs Q13162 Q6FHT3
Ensembl ID ENSP00000368646
Symbol PRX-4 AOE372 AOE37-2 HEL-S-97n
FamilyBelongs to the peroxiredoxin family. AhpC/Prx1 subfamily.
Sequence
MEALPLLAATTPDHGRHRRLLLLPLLLFLLPAGAVQGWETEERPRTREEECHFYAGGQVYPGEASRVSVADHSLHLSKAKISKPAPYWEGTAVIDGEFKELKLTDYRGKYLVFFFYPLDFTFVCPTEIIAFGDRLEEFRSINTEVVACSVDSQFTHLAWINTPRRQGGLGPIRIPLLSDLTHQISKDYGVYLEDSGHTLRGLFIIDDKGILRQITLNDLPVGRSVDETLRLVQAFQYTDKHGEVCPAGWKPGSETIIPDPAGKLKYFDKLN
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque697635PRDX4peroxiredoxin 49544Inparanoid, OMA, EggNOG
Mouse53381Prdx4peroxiredoxin 410090MGI:1859815Inparanoid, EggNOG
Rat85274Prdx4peroxiredoxin 410116RGD:620043Inparanoid, OMA, EggNOG
Dog100856588PRDX4peroxiredoxin 49615VGNC:44952Inparanoid, OMA, EggNOG
Horse100059985PRDX4peroxiredoxin 49796VGNC:21820Inparanoid, OMA, EggNOG
Cow281999PRDX4peroxiredoxin 49913VGNC:33302Inparanoid, OMA, EggNOG
Pig100152260PRDX4peroxiredoxin 49823Inparanoid, OMA, EggNOG
Opossum100012181PRDX4peroxiredoxin 413616Inparanoid, OMA, EggNOG
PlatypusPRDX4peroxiredoxin 4 [Source:HGNC Symbol;Acc:HGNC:17169]9258OMA, EggNOG
Chicken418601PRDX4peroxiredoxin 49031CGNC:12239Inparanoid, OMA, EggNOG
Anole lizard100553113prdx4peroxiredoxin 428377Inparanoid, OMA, EggNOG
Xenopus448526prdx4peroxiredoxin 48364XB-GENE-976761Inparanoid, OMA, EggNOG
Zebrafish570477prdx4peroxiredoxin 47955ZDB-GENE-030131-1096Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    oxidoreductase    /    peroxidase    /    Peroxiredoxin-4
DTO Classes
protein    /    Enzyme    /    Oxidoreductase    /    Peroxidase    /    Peroxiredoxin-4

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.