Recombinant Human HA-Ubiquitin Protein, >98%(SDS-PAGE)

Cat. No.: rp170435

GRADE & PURITY Carrier Free, Azide Free, His Tag, HA Tag, ≥98%(SDS-PAGE)

Expression System

E. coli

Accession #

P0CG47

Protein Tag

C-His & HA

Expression system

E. coli

Endotoxin Concentration

<1.0 EU/μg

Bioactivity

Testing in progress

Overview

Purity:>95%, by SDS-PAGE visualized with Coomassie® Blue Staining.
Description：
Ubiquitin is a 76 amino acid (aa) protein that is ubiquitously expressed in all eukaryotic organisms. Ubiquitin is highly conserved with 96% aa sequence identity shared between human and yeast Ubiquitin, and 100% aa sequence identity shared between human and mouse Ubiquitin (1). In mammals, four Ubiquitin genes encode for two Ubiquitin-ribosomal fusion proteins and two poly-Ubiquitin proteins. Cleavage of the Ubiquitin precursors by deubiquitinating enzymes gives rise to identical Ubiquitin monomers each with a predicted molecular weight of 8.6 kDa. Conjugation of Ubiquitin to target proteins involves the formation of an isopeptide bond between the C-terminal glycine residue of Ubiquitin and a lysine residue in the target protein. This process of conjugation, referred to as ubiquitination or ubiquitylation, is a multi-step process that requires three enzymes: a Ubiquitin-activating (E1) enzyme, a Ubiquitin-conjugating (E2) enzyme, and a Ubiquitin ligase (E3). Ubiquitination is classically recognized as a mechanism to target proteins for degradation and as a result, Ubiquitin was originally named ATP-dependent Proteolysis Factor 1 (APF-1). In addition to protein degradation, ubiquitination has been shown to mediate a variety of biological processes such as signal transduction, endocytosis, and post-endocytic sorting.

Specifications

Product Name

Recombinant Human HA-Ubiquitin Protein, >98%(SDS-PAGE)

Synonyms

RPS27A | UBA52 | UBB ubiquitin B | UBB | UBC | Ubiquitin

Grade

Azide Free, Carrier Free, HA Tag, His Tag

Specifications & Purity

Carrier Free, Azide Free, His-Tag, HA-Tag, ≥98%(SDS-PAGE)

Purity

>98%(SDS-PAGE)

Bioactivity

Testing in progress

Endotoxin Concentration

<1.0 EU/μg

Expression System

E. coli

Amino Acids

1-76 aa

Sequence

MHHHHHHYPYDVPDYAQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG

Protein Tag

C-His & HA

Accession #

P0CG47

Predicted molecular weight

10.5 kDa

SDS-PAGE

10.4 kDa, reducing conditions; 10.4 kDa, non-reducing conditions

Molecule Type

Protein

Storage and Shipping

Shape

Lyophilized

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.

Storage

Store at -20°C,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20°C for 1 year. Avoid freeze / thaw cycle.

Images

SDS-PAGE: Recombinant Human HA-Ubiquitin Protein (rp170435)

Recombinant Human HA-Ubiquitin Protein (rp170435) - SDS-PAGE
Recombinant Human HA-Ubiquitin Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 10.4 kDa.