224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Eosinophil cationic protein |
|---|
Gene and Protein Information
| Gene ID | 6037 |
|---|---|
| Uniprot Accession IDs | P12724 Q4VBC1 Q8WTP7 Q8WZ62 Q9GZN9 ECP |
| Ensembl ID | ENSP00000302324 |
| Symbol | ECP RNS3 ECP RAF1 RNS3 |
| Family | Belongs to the pancreatic ribonuclease family. |
| Sequence | MVPKLFTSQICLLLLLGLMGVEGSLHARPPQFTRAQWFAIQHISLNPPRCTIAMRAINNYRWRCKNQNTFLRTTFANVVNVCGNQSIRCPHNRTLNNCHRSRFRVPLLHCDLINPGAQNISNCTYADRPGRRFYVVACDNRDPRDSPRYPVVPVHLDTTI |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Mouse | 54159 | Rnase2b | ribonuclease, RNase A family, 2B (liver, eosinophil-derived neurotoxin) | 10090 | MGI:1858598 | Inparanoid, OMA |
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.