🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

LHX3

DescriptionLIM/homeobox protein Lhx3

Gene and Protein Information

Gene ID8022
Uniprot Accession IDs Q9UBR4 Q5TB39 Q5TB40 Q9NZB5 Q9P0I8 Q9P0I9 LIM homeobox protein 3
Ensembl ID ENSP00000360811
Symbol LIM3 CPHD3 M2-LHX3
Sequence
MLLETGLERDRARPGAAAVCTLGGTREIPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQREAEATAKRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEVSFPDEPSLAEMGPANGLYGSLGEPTQALGRPSGALGNFSLEHGGLAGPEQYRELRPGSPYGVPPSPAAPQSLPGPQPLLSSLVYPDTSLGLVPSGAPGGPPPMRVLAGNGPSSDLSTGSSGGYPDFPASPASWLDEVDHAQF
Show more
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp746333LHX3LIM homeobox 39598VGNC:4779OMA, EggNOG
Macaque574165LHX3LIM homeobox 39544Inparanoid, OMA, EggNOG
Mouse16871Lhx3LIM homeobox protein 310090MGI:102673Inparanoid, OMA, EggNOG
Rat170671Lhx3LIM homeobox 310116RGD:71078Inparanoid, OMA, EggNOG
Dog607584LHX3LIM homeobox 39615VGNC:42664Inparanoid, OMA
Horse100146197LHX3LIM homeobox 39796VGNC:19657Inparanoid, OMA
Cow539213LHX3LIM homeobox 39913VGNC:30873Inparanoid, OMA
Chicken373940LHX3LIM homeobox 39031CGNC:48967Inparanoid, OMA
Xenopus100489308lhx3LIM homeobox 38364XB-GENE-490075Inparanoid, OMA

Protein Classes

PANTHER Classes
protein    /    nucleic acid binding    /    RNA binding protein    /    LIM/homeobox protein Lhx3
DTO Classes
protein    /    Nucleic acid binding    /    RNA binding protein    /    LIM/homeobox protein Lhx3

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.