224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Dual specificity mitogen-activated protein kinase kinase 6 |
|---|
Gene and Protein Information
| Gene ID | 5608 |
|---|---|
| Uniprot Accession IDs | P52564 MAP kinase kinase 6 |
| Ensembl ID | ENSP00000468348 |
| Symbol | MEK6 MKK6 PRKMK6 SKK3 MEK6 MKK6 MAPKK6 PRKMK6 SAPKK3 SAPKK-3 |
| Family | Belongs to the protein kinase superfamily. STE Ser/Thr protein kinase family. MAP kinase kinase subfamily. |
| Sequence | MSQSKGKKRNPGLKIPKEAFEQPQTSSTPPRDLDSKACISIGNQNFEVKADDLEPIMELGRGAYGVVEKMRHVPSGQIMAVKRIRATVNSQEQKRLLMDLDISMRTVDCPFTVTFYGALFREGDVWICMELMDTSLDKFYKQVIDKGQTIPEDILGKIAVSIVKALEHLHSKLSVIHRDVKPSNVLINALGQVKMCDFGISGYLVDSVAKTIDAGCKPYMAPERINPELNQKGYSVKSDIWSLGITMIELAILRFPYDSWGTPFQQLKQVVEEPSPQLPADKFSAEFVDFTSQCLKKNSKERPTYPELMQHPFFTLHESKGTDVASFVKLILGD Show more |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 468310 | MAP2K6 | mitogen-activated protein kinase kinase 6 | 9598 | VGNC:9365 | OMA, EggNOG |
| Macaque | 693914 | MAP2K6 | mitogen-activated protein kinase kinase 6 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 26399 | Map2k6 | mitogen-activated protein kinase kinase 6 | 10090 | MGI:1346870 | Inparanoid, OMA, EggNOG |
| Rat | 114495 | Map2k6 | mitogen-activated protein kinase kinase 6 | 10116 | RGD:620666 | Inparanoid, OMA, EggNOG |
| Dog | 480454 | MAP2K6 | mitogen-activated protein kinase kinase 6 | 9615 | VGNC:42964 | Inparanoid, OMA, EggNOG |
| Horse | 100053056 | MAP2K6 | mitogen-activated protein kinase kinase 6 | 9796 | VGNC:19929 | Inparanoid, OMA |
| Cow | 286883 | MAP2K6 | mitogen-activated protein kinase kinase 6 | 9913 | VGNC:31187 | Inparanoid, OMA, EggNOG |
| Opossum | 100029049 | MAP2K6 | mitogen-activated protein kinase kinase 6 | 13616 | Inparanoid, OMA, EggNOG | |
| Chicken | 417445 | MAP2K6 | mitogen-activated protein kinase kinase 6 | 9031 | CGNC:50509 | OMA, EggNOG |
| Xenopus | 448132 | map2k6 | mitogen-activated protein kinase kinase 6 | 8364 | XB-GENE-944183 | Inparanoid, OMA, EggNOG |
| Zebrafish | 65239 | map2k6 | mitogen-activated protein kinase kinase 6 | 7955 | ZDB-GENE-010202-3 | Inparanoid, OMA |
| Fruitfly | 32257 | lic | licorne | 7227 | FBgn0261524 | Inparanoid, EggNOG |
Protein Classes
DTO Classes
protein / Kinase / Protein kinase / STE group / STE7 family / Dual specificity mitogen-activated protein kinase kinase 6
protein / Kinase / Protein kinase / STE group / STE7 family / Dual specificity mitogen-activated protein kinase kinase 6
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.