🌎 Enviar a: United States
Alternar navegación
Carrito
Buscar
Envío en el mismo día para todos los artículos en stock.
Búsqueda avanzada
Pedido rápido SDS / CoA Estructura A granel y personalizado
Menú
Cuenta
Configuración
྾
340,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Envío el mismo día para artículos en stock

CLIC4

DescripciónChloride intracellular channel protein 4

Gene and Protein Information

Gene ID25932
Uniprot Accession IDs Q9Y696 Q9UFW9 Q9UQJ6
Ensembl ID ENSP00000363500
Symbol H1 huH1 p64H1 CLIC4L MTCLIC
FamilyBelongs to the chloride channel CLIC family.
Sequence
MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNombreNIFOther Gene IDSources
Chimp749398CLIC4chloride intracellular channel 49598VGNC:10579OMA, EggNOG
Macaque712337CLIC4chloride intracellular channel 49544Inparanoid, OMA
Mouse29876Clic4chloride intracellular channel 4 (mitochondrial)10090MGI:1352754Inparanoid, OMA, EggNOG
Rat83718Clic4chloride intracellular channel 410116RGD:61857Inparanoid, OMA, EggNOG
Dog487367CLIC4chloride intracellular channel 49615VGNC:39340Inparanoid, OMA
Horse100071457CLIC4chloride intracellular channel 49796VGNC:16613Inparanoid, OMA
Cow286823CLIC4chloride intracellular channel 49913VGNC:27442Inparanoid, OMA
Opossum100012549CLIC4chloride intracellular channel 413616Inparanoid, OMA
Chicken419595CLIC4chloride intracellular channel 49031CGNC:861Inparanoid, OMA
Anole lizard100552159clic4chloride intracellular channel 428377Inparanoid, OMA
Zebrafish368255clic4chloride intracellular channel 47955ZDB-GENE-030326-3Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Ion channel    /    Intracellular chloride channel (clic) family    /    Chloride intracellular channel protein 4

Associated Recombinant Proteins

NombreSpecification and purityExpression systemProtein labelDisponibilidadMostrar detalles

Associated Antibodies

NombreEspecificacionesSpecies reactivityAplicaciónDisponibilidadMostrar detalles

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NombreDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      Utilizamos cookies para garantizar el correcto funcionamiento del sitio web y, cuando esté permitido, para mejorar su experiencia. Puede gestionar sus preferencias en cualquier momento en Configuración. Más información en nuestra Política de Cookies.

      ¿Quieres que te enviemos un mensaje cuando tengamos descuentos disponibles?

      Recordármelo más tarde

      ¡Gracias! Por favor, revisa tu bandeja de entrada de correo electrónico para confirmar.

      ¡Vaya! Las notificaciones están desactivadas.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corporation. All rights reserved.