🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

CLIC4

DescriptionChloride intracellular channel protein 4

Gene and Protein Information

Gene ID25932
Uniprot Accession IDs Q9Y696 Q9UFW9 Q9UQJ6
Ensembl ID ENSP00000363500
Symbol H1 huH1 p64H1 CLIC4L MTCLIC
FamilyBelongs to the chloride channel CLIC family.
Sequence
MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTK
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp749398CLIC4chloride intracellular channel 49598VGNC:10579OMA, EggNOG
Macaque712337CLIC4chloride intracellular channel 49544Inparanoid, OMA
Mouse29876Clic4chloride intracellular channel 4 (mitochondrial)10090MGI:1352754Inparanoid, OMA, EggNOG
Rat83718Clic4chloride intracellular channel 410116RGD:61857Inparanoid, OMA, EggNOG
Dog487367CLIC4chloride intracellular channel 49615VGNC:39340Inparanoid, OMA
Horse100071457CLIC4chloride intracellular channel 49796VGNC:16613Inparanoid, OMA
Cow286823CLIC4chloride intracellular channel 49913VGNC:27442Inparanoid, OMA
Opossum100012549CLIC4chloride intracellular channel 413616Inparanoid, OMA
Chicken419595CLIC4chloride intracellular channel 49031CGNC:861Inparanoid, OMA
Anole lizard100552159clic4chloride intracellular channel 428377Inparanoid, OMA
Zebrafish368255clic4chloride intracellular channel 47955ZDB-GENE-030326-3Inparanoid, OMA

Protein Classes

DTO Classes
protein    /    Ion channel    /    Intracellular chloride channel (clic) family    /    Chloride intracellular channel protein 4

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.