224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items
| Description | Proteasome inhibitor PI31 subunit |
|---|
Gene and Protein Information
| Gene ID | 9491 |
|---|---|
| Uniprot Accession IDs | Q92530 A0AVQ9 D3DVW3 Q9H4I1 hPI31 |
| Ensembl ID | ENSP00000338039 |
| Symbol | PI31 |
| Family | Belongs to the proteasome inhibitor PI31 family. |
| Sequence | MAGLEVLFASAAPAITCRQDALVCFLHWEVVTHGYFGLGVGDQPGPNDKKSELLPAGWNNNKDLYVLRYEYKDGSRKLLVKAITVESSMILNVLEYGSQQVADLTLNLDDYIDAEHLGDFHRTYKNSEELRSRIVSGIITPIHEQWEKANVSSPHREFPPATAREVDPLRIPPHHPHTSRQPPWCDPLGPFVVGGEDLDPFGPRRGGMIVDPLRSGFPRALIDPSSGLPNRLPPGAVPPGARFDPFGPIGTSPPGPNPDHLPPPGYDDMYL |
Homologous gene and protein info.
| Species | Gene ID | Gene Symbol | Name | Tax ID | Other Gene ID | Sources |
|---|---|---|---|---|---|---|
| Chimp | 458030 | PSMF1 | proteasome inhibitor subunit 1 | 9598 | VGNC:6252 | OMA, EggNOG |
| Macaque | 715314 | PSMF1 | proteasome inhibitor subunit 1 | 9544 | Inparanoid, OMA, EggNOG | |
| Mouse | 228769 | Psmf1 | proteasome (prosome, macropain) inhibitor subunit 1 | 10090 | MGI:1346072 | Inparanoid, OMA, EggNOG |
| Rat | 689852 | Psmf1 | proteasome inhibitor subunit 1 | 10116 | RGD:1587528 | Inparanoid, OMA, EggNOG |
| Dog | 477184 | PSMF1 | proteasome inhibitor subunit 1 | 9615 | VGNC:45120 | Inparanoid, OMA, EggNOG |
| Horse | 100053261 | PSMF1 | proteasome inhibitor subunit 1 | 9796 | VGNC:21968 | Inparanoid, OMA, EggNOG |
| Cow | 617807 | PSMF1 | proteasome inhibitor subunit 1 | 9913 | VGNC:33477 | Inparanoid, OMA, EggNOG |
| Opossum | 100011595 | PSMF1 | proteasome inhibitor subunit 1 | 13616 | Inparanoid, EggNOG | |
| Chicken | 430115 | PSMF1 | proteasome inhibitor subunit 1 | 9031 | CGNC:152 | Inparanoid, OMA, EggNOG |
| Anole lizard | 100564274 | psmf1 | proteasome inhibitor subunit 1 | 28377 | Inparanoid, OMA, EggNOG | |
| Zebrafish | 436820 | psmf1 | proteasome inhibitor subunit 1 | 7955 | ZDB-GENE-040718-282 | Inparanoid, OMA |
| Fruitfly | 36277 | PI31 | Proteasome inhibitor 31 kDa | 7227 | FBgn0033669 | Inparanoid, EggNOG |
Protein Classes
Associated Recombinant Proteins
| Name | Specification and purity | Expression system | Protein label | Availability | View Details |
|---|
Associated Antibodies
| Name | Specifications | Species reactivity | Application | Availability | View Details |
|---|
Associated Approved Drugs
Associated Active Ligands
Associated Diseases
| Name | Direct Associated Targets | Disease Type | Mondoid |
|---|
Bibliography
Remind me later
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.