CXCL10

DescriptionC-X-C motif chemokine 10

Gene and Protein Information

Gene ID3627
Uniprot Accession IDs P02778 Q96QJ5
Ensembl ID ENSP00000305651
Symbol INP10 SCYB10 C7 IFI10 INP10 IP-10 crg-2 mob-1 SCYB10 gIP-10
FamilyBelongs to the intercrine alpha (chemokine CxC) family.
Sequence
MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Chimp461242CXCL10C-X-C motif chemokine ligand 109598VGNC:8659OMA, EggNOG
Macaque574243CXCL10C-X-C motif chemokine ligand 109544Inparanoid, OMA, EggNOG
Mouse15945Cxcl10chemokine (C-X-C motif) ligand 1010090MGI:1352450Inparanoid, OMA, EggNOG
Rat245920Cxcl10C-X-C motif chemokine ligand 1010116RGD:620209Inparanoid, OMA, EggNOG
Dog478432CXCL10C-X-C motif chemokine ligand 109615VGNC:49645Inparanoid, OMA, EggNOG
Horse100050993CXCL10C-X-C motif chemokine ligand 109796VGNC:16981Inparanoid, OMA, EggNOG
Cow615107CXCL10C-X-C motif chemokine ligand 109913VGNC:27846Inparanoid, OMA, EggNOG

Protein Classes

PANTHER Classes
protein    /    signaling molecule    /    chemokine    /    C-X-C motif chemokine 10
DTO Classes
protein    /    Signaling    /    Chemokine    /    C-X-C motif chemokine 10

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.