🌎 Ship to: United States
Toggle Nav
Cart
Search
Same-day shipping on all in-stock items.
Advanced Search
Quick Order SDS CoA Structure
Menu
Account
Settings
྾
224,000+ research products · Triple ISO certified · COA & SDS available for every product · Same-day shipping on in-stock items

ID4

DescriptionDNA-binding protein inhibitor ID-4

Gene and Protein Information

Gene ID3400
Uniprot Accession IDs P47928 Q13005
Ensembl ID ENSP00000367972
Symbol BHLHB27 IDB4 bHLHb27
Sequence
MKAVSPVRPSGRKAPSGCGGGELALRCLAEHGHSLGGSAAAAAAAAAARCKAAEAAADEPALCLQCDMNDCYSRLRRLVPTIPPNKKVSKVEILQHVIDYILDLQLALETHPALLRQPPPPAPPHHPAGTCPAAPPRTPLTALNTDPAGAVNKQGDSILCR
Homologous gene and protein info.
SpeciesGene IDGene SymbolNameTax IDOther Gene IDSources
Macaque705825ID4inhibitor of DNA binding 4, HLH protein9544Inparanoid, OMA, EggNOG
Mouse15904Id4inhibitor of DNA binding 410090MGI:99414Inparanoid, OMA, EggNOG
Rat291023Id4inhibitor of DNA binding 4, HLH protein10116RGD:631428Inparanoid, OMA, EggNOG
HorseID4inhibitor of DNA binding 4, HLH protein [Source:HGNC Symbol;Acc:HGNC:5363]9796OMA, EggNOG
Pig100144508ID4inhibitor of DNA binding 4, HLH protein9823Inparanoid, OMA, EggNOG
Opossum100018112ID4inhibitor of DNA binding 4, HLH protein13616Inparanoid, OMA, EggNOG
Anole lizardID4inhibitor of DNA binding 4, HLH protein [Source:HGNC Symbol;Acc:HGNC:5363]28377Inparanoid, EggNOG
Xenopus448114id4inhibitor of DNA binding 4, HLH protein8364XB-GENE-876360Inparanoid, OMA, EggNOG
Zebrafish664761id4inhibitor of DNA binding 47955ZDB-GENE-051113-208Inparanoid, OMA, EggNOG

Associated Recombinant Proteins

NameSpecification and purityExpression systemProtein labelAvailabilityView Details

Associated Antibodies

NameSpecificationsSpecies reactivityApplicationAvailabilityView Details

Associated Approved Drugs

    Associated Active Ligands

      Associated Diseases

      NameDirect Associated TargetsDisease TypeMondoid

      Bibliography

      🔙[Back to Target (Human)]
      We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our Cookie Policy.

      Shall we send you a message when we have discounts available?

      Remind me later

      Thank you! Please check your email inbox to confirm.

      Oops! Notifications are disabled.

      Privacy Policy Terms of Use Cookie Policy Terms and Conditions of Sale Sales Policy
      Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
      Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.