The store will not work correctly when cookies are disabled.
Parece que JavaScript está deshabilitado en su navegador. Para obtener la mejor experiencia en nuestro sitio, asegúrese de activar Javascript en su navegador.
224,000+ productos de investigación · Triple ISO certified · COA & SDS Disponible para cada producto · Same-day shipping on in-stock items
FABP3 Descripción Fatty acid-binding protein, heart
Gene and Protein Information Gene ID 2170 Uniprot Accession IDs P05413 B2RAB6 Q5VV93 Q99957 Ensembl ID ENSP00000362817 Symbol FABP11 MDGI MDGI FABP11 H-FABP M-FABP O-FABP Family Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family. Sequence MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEA
Homologous gene and protein info.
Species Gene ID Gene Symbol Nombre NIF Other Gene ID Sources Chimp 456699 FABP3 fatty acid binding protein 3 9598 VGNC:6801 OMA, EggNOG Mouse 14074 Fabp3-ps1 fatty acid binding protein 3, muscle and heart, pseudogene 1 10090 MGI:101929 Inparanoid, OMA Rat 79131 Fabp3 fatty acid binding protein 3 10116 RGD:69048 Inparanoid, OMA, EggNOG Dog 478156 FABP3 fatty acid binding protein 3 9615 VGNC:40561 Inparanoid, OMA, EggNOG Horse 100033895 FABP3 fatty acid binding protein 3 9796 VGNC:17768 Inparanoid, OMA, EggNOG Cow 281758 FABP3 fatty acid binding protein 3 9913 VGNC:28697 Inparanoid, OMA, EggNOG Opossum FABP3 fatty acid binding protein 3 [Source:HGNC Symbol;Acc:HGNC:3557] 13616 Inparanoid, OMA, EggNOG Xenopus 548540 fabp3 fatty acid binding protein 3 8364 XB-GENE-974423 OMA, EggNOG Zebrafish 171478 fabp3 fatty acid binding protein 3, muscle and heart 7955 ZDB-GENE-020318-2 Inparanoid, OMA, EggNOG
Associated Recombinant Proteins Nombre Specification and purity Expression system Protein label Disponibilidad Mostrar detalles
Associated Antibodies
Nombre Specifications Species reactivity Aplicación Disponibilidad Mostrar detalles
Associated Approved Drugs Associated Active Ligands Associated Diseases Nombre Direct Associated Targets Disease Type Mondoid
We use cookies to ensure the website functions properly and, where permitted, to improve your experience. You can manage your preferences at any time in Settings. Learn more in our
Cookie Policy. Configuración Aceptar todo Rechazar
Shall we send you a message when we have discounts available?
Remind me later Permitir
Thank you! Please check your email inbox to confirm.
Oops! Notifications are disabled.
Products are supplied to verified businesses, institutions, and qualified professionals for research and development use only. Not for use in humans, animals, diagnosis, or therapy.
Copyright © 2023–present Aladdin Scientific Corp. All rights reserved.