Psalmotoxin-1 Acetate, CAS No.316808-68-1(free base)

CAS: 316808-68-1(free base) Cat. No.: P276298 Molecular Weight: 4689.41（free base）

GRADE & PURITY BioReagent, ≥95%(HPLC)

Accession #

P60514

Overview

Psalmotoxin 1 (PcTx1) is a protein toxin that can bind at subunit-subunit interfaces of acid-sensing ion channel 1a (ASIC1a). Psalmotoxin 1 is a potent and selective ASIC1a inhibitor (IC₅₀: 0.9 nM) by increasing the apparent affinity for H⁺ of ASIC1a. Psalmotoxin 1 can induce cell apoptosis, also inhibits cell migration, proliferation and invasion of cancer cells. Psalmotoxin 1 can be used in the research of cancers, or neurological disease.

Sequence: Glu-Asp-Cys-Ile-Pro-Lys-Trp-Lys-Gly-Cys-Val-Asn-Arg-His-Gly-Asp-Cys-Cys-Glu-Gly-Leu-Glu-Cys-Trp-Lys-Arg-Arg-Arg-Ser-Phe-Glu-Val-Cys-Val-Pro-Lys-Thr-Pro-Lys-Thr (Disulfide bridge: Cys3-Cys18, Cys10-Cys23, Cys17-Cys33)

Formula:  C₂₀₀H₃₁₂N₆₂O₅₇S₆・xC₂H₄O₂

Molecular weight: 4689.41（free base） 

Specifications

Product Name

Psalmotoxin-1 Acetate, CAS No.316808-68-1(free base)

Synonyms

PcTx1 Acetate | PcTx1 | Psalmopoeus cambridgei toxin-1 | Psalmotoxin 1 | PcTx1 Acetate

Grade

BioReagent

Specifications & Purity

BioReagent, ≥95%(HPLC)

Biochemical and Physiological Mechanisms

This toxin is a gating modifier that acts principally as an inhibitor on ASIC1a (ASIC isoform 2) and a potentiator on ASIC1b (ASIC isoform 3). This toxin potently and selectively inhibits rat, mouse and human ASIC1a (IC50=0.35-3.7 nM). The blockade is rap

Amino Acids

1-40 aa

Sequence

EDCIPKWKGCVNRHGDCCEGLECWKRRRSFEVCVPKTPKT

Accession #

P60514

Predicted molecular weight

4689.41（free base）

Note

Wherever possible, you should prepare and use solutions on the same day. However, if you need to make up stock solutions in advance, we recommend that you store the solution as aliquots in tightly sealed vials at -20°C. Generally, these will be useable for up to one week. Before use, and prior to opening the vial we recommend that you allow your product to equilibrate to room temperature for at least 1 hour. Need more advice on solubility, usage and handling? Please visit our frequently asked questions (FAQ) page for more details.

CAS

316808-68-1(free base)

Molecule Type

Peptide

Storage and Shipping

Reconstitution

Reconstitute in water.

Storage

Protected from light,Store at -20°C,Desiccated,Avoid repeated freezing and thawing

Shipped In

Ice chest + Ice pads

Stability And Storage

Store at -20℃ long term (24 months). Upon reconstitution, it is recommended to aliquot. Avoid freeze/thaw cycle. Store in the dark. Desiccated.