Recombinant Human IL-1 alpha/IL-1F1 Protein

Cat. No.: rp228946
AVAILABLE TO ORDER
GRADE & PURITY Animal Free ? Animal-free — produced without animal-derived components to reduce contamination risk. Use in biomanufacturing and culture avoiding animal-origin material. Carrier Free ? Carrier-free — supplied without added carrier protein/stabilizer. Use when carriers (e.g. BSA) would interfere with conjugation or sensitive assays. Bioactive ? Bioactive grade — verified to retain biological activity in functional assays. Use when the molecule must be functionally active, not just pure. ActiBioPure™ ? ActiBioPure™ — Aladdin's premier line for bioactive and recombinant products. Use when both high purity and preserved biological activity are required. ≥95%(SDS-PAGE) expressed in E. coli; See COA
Accession #
P01583
Protein Tag
No tag
Expression system
E. coli
Endotoxin Concentration
<1.0 EU/μg
Bioactivity
Immobilized Recombinant Human IL-1 alpha Protein (rp228946) at 2.0 μg/mL can bind Bermekimab (anti-IL-1a) (Ab175470) with the EC50 of 17.6 ng/mL.
 ·  off list, applied to all prices below.
Size
Status
Price
Qty
10μg
rp228946-10μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$89.90
50μg
rp228946-50μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$269.90
100μg
rp228946-100μg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$429.90
1mg
rp228946-1mg
1-2 wks(?)
Item is derived from our semi-finished stock and is processed in 1-2 weeks.
$2,999.90
Enter a quantity for the sizes you want to add.
🧪

Why this grade

Animal Free,Carrier Free,Bioactive,ActiBioPure™,≥95%(SDS-PAGE),expressed in E. coli; See COA ActiBioPure™,Animal Free,Bioactive,Carrier Free for sensitive chromatographic and analytical workflows requiring minimal baseline interference.

🌡

Storage & shipping

Store at -20°C,Avoid repeated freezing and thawing Ships Ice chest + Ice pads Check lot-specific COA for exact specifications.

📋

Quality documents

SDS, COA, datasheet, and spec sheet available for download. Lot-specific COA accessible via lot number lookup.

📚

Literature proof

Cited in 0 peer-reviewed publications across chromatography, organic synthesis, and cross-coupling reactions.

Specifications

Product Name
Recombinant Human IL-1 alpha/IL-1F1 Protein
Synonyms
BAF | FAF | Hematopoietin 1 | Hematopoietin-1 | IL 1 alpha | IL 1A | IL-1 alpha | Il-1a | IL1 | IL1 ALPHA | IL1A | IL1A_HUMAN | IL1F1 | Interleukin 1 alpha | Interleukin-1 alpha | Interleukin1 alpha | LAF | LEM | Preinterleukin 1 alpha | Pro interleukin 1
Grade
ActiBioPure™, Animal Free, Bioactive, Carrier Free
Specifications & Purity
Animal Free, Carrier Free, Bioactive, ActiBioPure™, ≥95%(SDS-PAGE), expressed in E. coli; See COA
Biochemical and Physiological Mechanisms
Interleukin 1 (IL-1) is a name that designates two proteins, IL-1 alpha and IL-1 beta, which are the products of distinct genes, but which show approximately 25% amino acid sequence identity and which recognize the same cell surface receptors. Although IL
Bioactivity
Immobilized Recombinant Human IL-1 alpha Protein (rp228946) at 2.0 μg/mL can bind Bermekimab (anti-IL-1a) (Ab175470) with the EC50 of 17.6 ng/mL.
Endotoxin Concentration
<1.0 EU/μg
Amino Acids
113-271 aa
Sequence
SAPFSFLSNVKYNFMRIIKYEFILNDALNQSIIRANDQYLTAAALHNLDEAVKFDMGAYKSSKDDAKITVILRISKTQLYVTAQDEDQPVLLKEMPEIPKTITGSETNLLFFWETHGTKNYFTSVAHPNLFIATKQDYWVCLAGGPPSITDFQILENQA
Accession #
Predicted molecular weight
18.0 kDa
SDS-PAGE
16.2 kDa; under reducing conditions; 16.6 & 33.5 kDa; under non-reducing conditions.
Molecule Type
Protein
Storage and Shipping
Concentration
expressed in E. coli; See COA
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute at 0.5 mg/mL in sterile distilled water. Stock solutions should be apportioned into working aliquots and stored at ≤ -20 °C. Further dilutions should be made in appropriate buffered solutions.
Storage
Store at -20°C,Avoid repeated freezing and thawing
Shipped In
Ice chest + Ice pads
Stability And Storage
Store at -20℃ for 12 months. Upon reconstitution; it is recommended to aliquot. Avoid freeze/thaw cycle.
Images
Recombinant Human IL-1 alpha/IL-1F1 Protein (rp228946) - ELISA 
Immobilized Recombinant Human IL-1 alpha/IL-1F1 Protein (rp228946) at 2.0 μg/mL can bind Bermekimab (anti-IL-1a) (Ab175470) with the EC₅₀ of 17.6 ng/mL.
Recombinant Human IL-1 alpha/IL-1F1 Protein (rp228946) - SDS-PAGE 
3 μg/lane of Recombinant Human IL-1 alpha/IL-1F1 Protein was resolved with SDS-PAGE under reducing (R) and non-reducing (N) conditions and visualized by Coomassie® Blue staining, showing a band at 16.2 kDa under reducing conditions and 16.6 & 33.5 kDa under non-reducing conditions. 
IL-1 alpha/IL-1F1 can form dimers through hydrophobic interactions under non-reducing conditions (PMID: 3288634).

Documentation

📋 Safety Data Sheet (SDS)

Comprehensive hazard, handling, storage, and regulatory compliance document.

Download SDS →

✅ Certificate of Analysis (COA)

Lot-specific quality data. Enter your lot number to retrieve the exact COA.

Look up COA →

📊 Datasheet

Quick-reference summary of product specifications and applications.

View datasheet →

🔬 Specification Sheet

Full quality attributes and acceptance criteria for this grade.

View spec sheet →

Advanced Data

Certificates(CoA,COO,BSE/TSE and Analysis Chart)
C of A & Other Certificates(BSE/TSE, COO):
Analytical Chart:

Find and download the COA for your product by matching the lot number on the packaging.

3 results found

Lot NumberCertificate TypeDateItem
ZJ26F0535194Certificate of AnalysisMay 12, 2026 rp228946
ZJ26F0535193Certificate of AnalysisMay 12, 2026 rp228946
ZJ26F0535192Certificate of AnalysisMay 12, 2026 rp228946
Solution Calculators
Reviews

Customer Reviews

Shall we send you a message when we have discounts available?

Remind me later

Thank you! Please check your email inbox to confirm.

Oops! Notifications are disabled.